DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc3 and tbx-41

DIOPT Version :9

Sequence 1:NP_648280.1 Gene:Doc3 / 39036 FlyBaseID:FBgn0035954 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_508343.2 Gene:tbx-41 / 188917 WormBaseID:WBGene00006560 Length:156 Species:Caenorhabditis elegans


Alignment Length:146 Identity:32/146 - (21%)
Similarity:56/146 - (38%) Gaps:45/146 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 HKYQP-RLHVIRTSDLGQIPWAPQQAFIFPETEFIAVTAYQNDRITKLKIDNNPFAKGFRESGQS 245
            |..|| .:|.:.:..|             |.| |:.||.|:|.....||:..||.|:.|.::..:
 Worm    23 HMQQPATMHRVSSCRL-------------PYT-FMTVTMYKNREARVLKLGMNPHARHFLKNNTN 73

  Fly   246 RCKRKINDSPPPTQPEANQVDRSPVTSPLAKRLRLVEEFPQHHHHQSHHSVPMQRHYLLDALEAN 310
            :                |.:|.:.:..|:.. ::.:..||...:..|:       .:..|...:|
 Worm    74 K----------------NHLDTASLIPPIPS-VQPLPLFPLPQNSMSY-------TFSYDTYPSN 114

  Fly   311 FYVPAP-----PPPAI 321
            .:| ||     |.||:
 Worm   115 IHV-APIQLPFPFPAV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc3NP_648280.1 TBOX 58..245 CDD:238106 18/63 (29%)
tbx-41NP_508343.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.