DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc3 and TBR1

DIOPT Version :9

Sequence 1:NP_648280.1 Gene:Doc3 / 39036 FlyBaseID:FBgn0035954 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_006584.1 Gene:TBR1 / 10716 HGNCID:11590 Length:682 Species:Homo sapiens


Alignment Length:428 Identity:148/428 - (34%)
Similarity:194/428 - (45%) Gaps:76/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAQEIYRQQIMQRLPD--PLCGL-LPNFAGHFMPPPP-----PPQPTL-PGDVEAKLENNELWQQ 71
            |....|...:....|.  |..|. .|...||.....|     ..||.| ||..:..|.|..||.:
Human   152 ITNGAYNSLLSNSSPQGYPTAGYPYPQQYGHSYQGAPFYQFSSTQPGLVPGKAQVYLCNRPLWLK 216

  Fly    72 FHSIGTEMIITKCGRRMFPSMRVSLSGLEEEASYCVLLEMVPIGDCRYKFSGSQWVPAGGAEPQ- 135
            ||...|||||||.||||||.:..::|||:..|.|.:.::::......::|.|.:|||.|.|:.. 
Human   217 FHRHQTEMIITKQGRRMFPFLSFNISGLDPTAHYNIFVDVILADPNHWRFQGGKWVPCGKADTNV 281

  Fly   136 SPQRMYLHPESPATGKHWQSQALLFSKVKLTNN--TLDNNGH-IVLASMHKYQPRLHVIR----- 192
            ...|:|:||:||.||.||..|.:.|.|:|||||  ..:|||. :||.|:|||||||||:.     
Human   282 QGNRVYMHPDSPNTGAHWMRQEISFGKLKLTNNKGASNNNGQMVVLQSLHKYQPRLHVVEVNEDG 346

  Fly   193 ---TSDLGQIPWAPQQAFIFPETEFIAVTAYQNDRITKLKIDNNPFAKGFRES--------GQSR 246
               ||..|::     |.|.||||:|||||||||..||:||||:||||||||::        ...|
Human   347 TEDTSQPGRV-----QTFTFPETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDTIYTGCDMDR 406

  Fly   247 CKRKINDSPPPTQPEANQVDRSPVTSPLAKRLRLVEEFPQHHHHQSHHSVPMQRHYLLDALEANF 311
            .....||||           ||.:..  ..|..:...|             :|..::.:..:|.|
Human   407 LTPSPNDSP-----------RSQIVP--GARYAMAGSF-------------LQDQFVSNYAKARF 445

  Fly   312 YVPA---PPPPAIEYARHIGGAY-PSWAYTPPSPASSVSSSSAGSTSGESAADREADADADTFVD 372
            :..|   |.|.......|..|.. |..|..|.:|    |......|...:..|..|.| .||..|
Human   446 HPGAGAGPGPGTDRSVPHTNGLLSPQQAEDPGAP----SPQRWFVTPANNRLDFAASA-YDTATD 505

  Fly   373 VVGTAP-----AAPPPPSPPVPATATA--PASSSSDPT 403
            ..|.|.     ||....:.|:.|....  |....:||:
Human   506 FAGNAATLLSYAAAGVKALPLQAAGCTGRPLGYYADPS 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc3NP_648280.1 TBOX 58..245 CDD:238106 96/206 (47%)
TBR1NP_006584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..127
T-box_TBR1 203..393 CDD:410330 95/194 (49%)
T-box_assoc 418..680 CDD:406561 31/146 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..483 10/39 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 588..658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.