DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and Wwtr1

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001161753.1 Gene:Wwtr1 / 97064 MGIID:1917649 Length:452 Species:Mus musculus


Alignment Length:259 Identity:51/259 - (19%)
Similarity:91/259 - (35%) Gaps:89/259 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 HIKILLTNCLTLLPELKPENHADSLSLALFLHTLVVFTAPKSWAILRNAQFEKLQPAMQKICCNI 201
            |.:::.|:       |.|:||...             ..|.....:.|| ....|...||:    
Mouse   252 HQQVVATS-------LSPQNHPTQ-------------NQPTGLMSVPNA-LTTQQQQQQKL---- 291

  Fly   202 QGHLVQHDFYKIMRLVLIRGTVR---EELSVKPVTL---VAIITLCLRPLIDGNFSRNLLAKFLS 260
                      ::.|:.:.|..:|   |||..:...|   :.:.|..:.|:.....|.::  :.::
Mouse   292 ----------RLQRIQMERERIRMRQEELMRQEAALCRQLPMETETMAPVNTPAMSTDM--RSVT 344

  Fly   261 EILSVPAL---IYHLQQ------------SVPQCLEQF-SSMGLL-------KKALSISGDVQWF 302
            ...|.|.|   .||.::            |||...|.| |:|..:       :..::::.....|
Mouse   345 NSSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNMDEMDTGENSGQTPMTVNPQQTRF 409

  Fly   303 EEFGTSMPGTKSLAFLGNIVNLFNID-GQGESKELAYPLLTETTTSLLELIPNTVTTKGVFTQW 365
            .:|...:|||             |:| |..||::| .||..:..::|.:..|        |..|
Mouse   410 PDFLDCLPGT-------------NVDLGTLESEDL-IPLFNDVESALNKSEP--------FLTW 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033
HECTc 718..1075 CDD:214523
Wwtr1NP_001161753.1 WW 182..213 CDD:197736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.