DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and GAS7

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_958839.1 Gene:GAS7 / 8522 HGNCID:4169 Length:476 Species:Homo sapiens


Alignment Length:132 Identity:33/132 - (25%)
Similarity:56/132 - (42%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ASFLEQTKAARE-ERALEKRREQAAILL----QSTLKGYAARRK--------------YQKRIIL 53
            ||..:..||..| :|.||.:.:|..|.|    :..:|  .||||              |.:....
Human   334 ASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIK--KARRKSTQAGDDLMRCVDLYNQAQSK 396

  Fly    54 DFDAMFTENHDDKDAELELVASNVYPVLRRYL---TQIR--LDKSDVRARERLERICRYIIKAME 113
            .|:.|.|...:.:..|:|.|     .::|::|   ||:|  .|..:....|.::::.|.:..|.:
Human   397 WFEEMVTTTLELERLEVERV-----EMIRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKD 456

  Fly   114 SE 115
            .|
Human   457 RE 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033
HECTc 718..1075 CDD:214523
GAS7NP_958839.1 SH3_GAS7 5..57 CDD:212763
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..171
WW_FCH_linker 109..201 CDD:374680
F-BAR_GAS7 214..446 CDD:153333 30/118 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.