DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and Nedd4l

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:XP_036017204.1 Gene:Nedd4l / 83814 MGIID:1933754 Length:1261 Species:Mus musculus


Alignment Length:427 Identity:121/427 - (28%)
Similarity:207/427 - (48%) Gaps:50/427 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 MPHIIPHEDRVKLFRKFVQNEKAVMGLTESACASPRSALIVIHRDRIVEDGYRQ-LAAQPTQALK 718
            :|:....:.:...|||.::....:          |....:.:||:.|.|:.||: ::.:....||
Mouse   877 VPYSREFKQKYDYFRKKLKKPADI----------PNRFEMKLHRNNIFEESYRRIMSVKRPDVLK 931

  Fly   719 GVIRVRFINQQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFK--TTSDQRLYPSPIS-YVQDN 780
            ..:.:.|.:::||     |..||.:|:.....|::|:|...||:  .|.:..|..:|.| ...::
Mouse   932 ARLWIEFESEKGL-----DYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNED 991

  Fly   781 HLELFEFVGRMLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTFIKH 845
            ||..|.|:||:.|.||:.|.::|..|...|...:||:     ...::::.|:|:|.|.||.:|  
Mouse   992 HLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGK-----QITLNDMESVDSEYYNSLKWI-- 1049

  Fly   846 YKQDVSDLNLTFSVDQDVMGKIVTLALHPGGKARVVNDHNKLVYIHYMAFFHMNTQIREQTIAFN 910
            .:.|.::|:|.|.:|::..|:...:.|.|.|...:|.:.||..||..:..:....::::|..||.
Mouse  1050 LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFL 1114

  Fly   911 RGFRSIVNPEWLSLFSPPELQRLISGDTSPLDLKDLQKHTHYYGGFHDTHQVVCWLWD-ILAKDF 974
            .||..::..:.:.:|...||:.|:.| ...:|:.|.::|:.|..|:...|.|:.|.|. :|..| 
Mouse  1115 EGFTELLPIDLIKIFDENELELLMCG-LGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMD- 1177

  Fly   975 TEEERKLFLKFVTSCSKPPLLGFAHLEPPFSIRCVEVSDDEDTGDTIGSVIRGFFAIRKKDPLNR 1039
             .|:|...|:|||..|:.|:.|||.|                    .||.....|.|.:.....:
Mouse  1178 -AEKRIRLLQFVTGTSRVPMNGFAEL--------------------YGSNGPQLFTIEQWGSPEK 1221

  Fly  1040 LPTSSTCFNLLKLPNYQKKSTLRDKLRYAVSSNTGFE 1076
            ||.:.||||.|.||.|:....||:||..||.:..|||
Mouse  1222 LPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 1258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 114/386 (30%)
HECTc 718..1075 CDD:214523 106/360 (29%)
Nedd4lXP_036017204.1 PHA03378 <107..318 CDD:223065
C2 <367..420 CDD:417471
WW 465..491 CDD:395320
WW 655..684 CDD:395320
WW 768..798 CDD:238122
WW 817..867 CDD:197736
HECTc 928..1257 CDD:214523 107/363 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.