DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and UVR8

DIOPT Version :10

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_201191.1 Gene:UVR8 / 836506 AraportID:AT5G63860 Length:440 Species:Arabidopsis thaliana


Alignment Length:68 Identity:16/68 - (23%)
Similarity:27/68 - (39%) Gaps:22/68 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 QNEKAVMGLTESACASPRSALIVIHRDRIVEDGYRQLAAQPTQALKGVIRVRFINQQGLHEAGID 737
            :|:...:||.::                  ||   .|..|..||.:| ||::.:.....|.|.:.
plant   146 RNQNGQLGLGDT------------------ED---SLVPQKIQAFEG-IRIKMVAAGAEHTAAVT 188

  Fly   738 QDG 740
            :||
plant   189 EDG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 IQCD 20..50 CDD:467745
HECTc 694..1076 CDD:238033 13/47 (28%)
UVR8NP_201191.1 ATS1 20..371 CDD:444065 16/68 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.