DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and SMURF1

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_065162.1 Gene:SMURF1 / 57154 HGNCID:16807 Length:757 Species:Homo sapiens


Alignment Length:490 Identity:133/490 - (27%)
Similarity:216/490 - (44%) Gaps:82/490 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 PKHWLIPEVKP--STFINDLEKAKRNAMLLLAKMPHIIPHEDRVK-------------------- 666
            |..|   ||:.  |..|..::...|.......::.||:.|:.::|                    
Human   309 PPGW---EVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELP 370

  Fly   667 ---LFRKFVQNEKAVMGLTESACASPRS--ALIVIHRDRIVEDGYRQLAAQPTQALKGVIRVRFI 726
               ..|..||..|.:.  .|.:...|::  ..|.:.|:.|.|:.|||:.....:.||..:.|:|.
Human   371 AQRYERDLVQKLKVLR--HELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFR 433

  Fly   727 NQQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFKTTSDQ--RLYPSPISYVQDNHLELFEFVG 789
            .::||     |..||.:|:|.....::.:|...||:.::|.  .|..:|.|.:..:||..|.|||
Human   434 GEEGL-----DYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVG 493

  Fly   790 RMLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTFIKHYKQDVSD-L 853
            |::|.||:.|..::..|...|..||||:..|     :.:|.|:|.||::||.:|  .:.|::. |
Human   494 RIMGLAVFHGHYINGGFTVPFYKQLLGKPIQ-----LSDLESVDPELHKSLVWI--LENDITPVL 551

  Fly   854 NLTFSVDQDVMGKIVTLALHPGGKARVVNDHNKLVYIHYMAFFHMNTQIREQTIAFNRGFRSIVN 918
            :.||.|:.:..|:|:...|.|.|:...|.:.||..|:.....:.....|..|.:|..:||..::.
Human   552 DHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIP 616

  Fly   919 PEWLSLFSPPELQRLISGDTSPLDLKDLQKHTHYYGGFHDTHQVVCWLWDILAKDFTEEERKLFL 983
            ...|..|...||: ||.|....:||.|.:.:|.......|:: :|.|.|..: :.|.||.|...|
Human   617 QHLLKPFDQKELE-LIIGGLDKIDLNDWKSNTRLKHCVADSN-IVRWFWQAV-ETFDEERRARLL 678

  Fly   984 KFVTSCSKPPLLGFAHLEPP--------FSIRCVEVSDDEDTGDTIGSVIRGFFAIRKKDPLNRL 1040
            :|||..::.||.||..|:..        |:|..::.:.|                        .|
Human   679 QFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTD------------------------NL 719

  Fly  1041 PTSSTCFNLLKLPNYQKKSTLRDKLRYAVSSNTGF 1075
            |.:.||||.:.:|.|:....|.:||..||....||
Human   720 PKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGF 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 116/393 (30%)
HECTc 718..1075 CDD:214523 106/367 (29%)
SMURF1NP_065162.1 C2_Smurf-like 14..138 CDD:176028
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..237
WW 236..267 CDD:197736
WW 307..339 CDD:197736 7/32 (22%)
HECTc 399..754 CDD:238033 114/393 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.