DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and WWC3

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_056506.2 Gene:WWC3 / 55841 HGNCID:29237 Length:1092 Species:Homo sapiens


Alignment Length:228 Identity:47/228 - (20%)
Similarity:83/228 - (36%) Gaps:73/228 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NQKASFLEQTKAAREERALEKRR----EQAAILLQSTLKGYAARRKYQKRII-LDFDAM------ 58
            |.:..|||:..:..:||...:.|    .::..:::|......||.:|..|:. .|.|:.      
Human   872 NTEDLFLEEAASLVKERPSRRARGSPFVRSGTIVRSQTFSPGARSQYVCRLYRSDSDSSTLPRKS 936

  Fly    59 -FTENHDDK----------------------DAELELVAS-------NVYPVLRRYLTQIRLDKS 93
             |..|..::                      |.||:|.||       |......|.|.| ||:.:
Human   937 PFVRNTLERRTLRYKQSCRSSLAELMARTSLDLELDLQASRTRQRQLNEELCALRELRQ-RLEDA 1000

  Fly    94 DVRAR----------ERLERICRYIIKAMESENTKLSY----AALCLFKERSLPWIAHIKILLTN 144
            .:|.:          |||..:.|...:  ::..|||.|    ||..:.|:.|..           
Human  1001 QLRGQTDLPPWVLRDERLRGLLREAER--QTRQTKLDYRHEQAAEKMLKKASKE----------- 1052

  Fly   145 CLTLLPELKPENHADSLSLALFLHTLVVFTAPK 177
                :.:|:.::|.:.:.:..|...:..||.|:
Human  1053 ----IYQLRGQSHKEPIQVQTFREKIAFFTRPR 1081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033
HECTc 718..1075 CDD:214523
WWC3NP_056506.2 THOC7 <4..119 CDD:283305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 363..384
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..488
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 510..544
C2_Kibra 602..725 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.