DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and HUWE1

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster


Alignment Length:414 Identity:125/414 - (30%)
Similarity:198/414 - (47%) Gaps:45/414 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 RKFVQNEKAVMGLTESACASPRSALIVIHRDRIVEDGYRQLAAQPTQALKGVIRVRFINQQGLHE 733
            ||:.|.|  :..|.|.......:  :.:.|..:.||.:|.|.....:..|....:.|.:::| .:
  Fly  4775 RKYFQTE--LERLDEGIRREEHT--VSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDEEG-QD 4834

  Fly   734 AGIDQDGVFKEFLEETIKKVFDPSLNLFKTTSDQRL--YPSPISYVQDNHLELFEFVGRMLGKAV 796
            ||    |:.:|:.....:::|:|...||..:...|:  ..:|.|:...|||..|:||||::.|||
  Fly  4835 AG----GLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAV 4895

  Fly   797 YEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTFIKHYKQDVSDL--NLTFSV 859
            ::..:::..|...|...:||  :|..::.|:   |.|.|.|:.|.::  .|.|:|.|  .||||.
  Fly  4896 HDNKLLECYFTRSFYKHILG--KQVKHTDME---SQDYEFYKGLDYL--MKNDISTLGYELTFST 4953

  Fly   860 DQDVMGKIVTLALHPGGKARVVNDHNKLVYIHYMAFFHMNTQIREQTIAFNRGFRSIVNPEWLSL 924
            :....|......|.|.|:...|.:.||..|:..:....|:..||:|..||..||..|:....:|:
  Fly  4954 EVQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISI 5018

  Fly   925 FSPPELQRLISGDTSPLDLKDLQKHTHYYGGFHDTHQVVCWLWDILAKDFTEEERKLFLKFVTSC 989
            |:..||:.|||| ...:|::||:.:|.|:.....:.|:. |.|..| :.|.:.:|..||:|||..
  Fly  5019 FNEQELELLISG-LPDIDIEDLKANTEYHKYTSKSAQIQ-WFWRAL-RSFDQADRAKFLQFVTGT 5080

  Fly   990 SKPPLLGFAHLEPPFSIRCVEVSDDEDTGDTIGSVIRGFFAIRKKDPLNRLPTSSTCFNLLKLPN 1054
            ||.||.||..||....|:..::..|:.:.|                   |||.:.||||.|.||.
  Fly  5081 SKVPLQGFGSLEGMNGIQKFQIHRDDRSTD-------------------RLPCAHTCFNQLDLPM 5126

  Fly  1055 YQKKSTLRDKLRYAV---SSNTGF 1075
            |:....||..|..|:   |...||
  Fly  5127 YKSYDKLRSCLLKAIHECSEGFGF 5150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 119/389 (31%)
HECTc 718..1075 CDD:214523 112/363 (31%)
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033 117/386 (30%)
HECTc 4820..5148 CDD:214523 112/361 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446987
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.