DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and smurf1

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001001943.1 Gene:smurf1 / 321695 ZFINID:ZDB-GENE-040426-2744 Length:731 Species:Danio rerio


Alignment Length:417 Identity:128/417 - (30%)
Similarity:198/417 - (47%) Gaps:40/417 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   665 VKLFRKFVQNEKAVMGLTESACASPRS--ALIVIHRDRIVEDGYRQLAAQPTQALKGVIRVRFIN 727
            |:..|..||..|.:.  .|.:...|::  ..|.:.|:.|.|:.|||:.....:.||..:.|:|..
Zfish   346 VRYERDLVQKLKVLR--HELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRG 408

  Fly   728 QQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFKTTSDQ--RLYPSPISYVQDNHLELFEFVGR 790
            ::||     |..||.:|:|.....::.:|...||:.::|.  .|..:|.|.:..:||..|.||||
Zfish   409 EEGL-----DYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGR 468

  Fly   791 MLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTFIKHYKQDV-SDLN 854
            ::|.||:.|..::..|...|..||||:..|     :.:|.::|.||::||.:|  .:.|: |.|:
Zfish   469 IMGLAVFHGHYINGGFTLPFYKQLLGKPIQ-----LCDLETVDPELHKSLVWI--LENDITSVLD 526

  Fly   855 LTFSVDQDVMGKIVTLALHPGGKARVVNDHNKLVYIHYMAFFHMNTQIREQTIAFNRGFRSIVNP 919
            .||.|:.:..||.:...|.|.||...|.:.||..|:.....:.....|..|.:|..:||..::..
Zfish   527 HTFCVEHNAFGKFLQHELKPNGKNIPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQ 591

  Fly   920 EWLSLFSPPELQRLISGDTSPLDLKDLQKHTHYYGGFHDTHQVVCWLWDILAKDFTEEERKLFLK 984
            ..|..|...||: ||.|....:||.|.:.:|.......|:: :|.|.|..: :.|.||.|...|:
Zfish   592 HLLKPFDNKELE-LIIGGLGKIDLNDWKANTRLKHCVADSN-IVKWFWQAV-ESFDEERRGRLLQ 653

  Fly   985 FVTSCSKPPLLGFAHLEPPFSIRCVEVSDDEDTGDTIGSVIRGFFAIRKKDP-LNRLPTSSTCFN 1048
            |||..::.||.||..|:                |.| ||.....|.|...|. .:.||.:.||||
Zfish   654 FVTGSTRVPLQGFKALQ----------------GST-GSAGPRLFTIHLIDANTDNLPKAHTCFN 701

  Fly  1049 LLKLPNYQKKSTLRDKLRYAVSSNTGF 1075
            .:.:|.|:....|.:||..||....||
Zfish   702 RIDIPPYESYEKLYEKLLTAVEETCGF 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 121/386 (31%)
HECTc 718..1075 CDD:214523 111/360 (31%)
smurf1NP_001001943.1 C2_Smurf-like 14..138 CDD:176028
WW 234..266 CDD:197736
WW 280..312 CDD:197736
HECTc 373..728 CDD:238033 119/386 (31%)
HECTc 397..728 CDD:214523 112/362 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.