DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and NEDD4L

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:XP_006722489.1 Gene:NEDD4L / 23327 HGNCID:7728 Length:1019 Species:Homo sapiens


Alignment Length:427 Identity:121/427 - (28%)
Similarity:207/427 - (48%) Gaps:50/427 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 MPHIIPHEDRVKLFRKFVQNEKAVMGLTESACASPRSALIVIHRDRIVEDGYRQ-LAAQPTQALK 718
            :|:....:.:...|||.::....:          |....:.:||:.|.|:.||: ::.:....||
Human   635 VPYSREFKQKYDYFRKKLKKPADI----------PNRFEMKLHRNNIFEESYRRIMSVKRPDVLK 689

  Fly   719 GVIRVRFINQQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFK--TTSDQRLYPSPIS-YVQDN 780
            ..:.:.|.:::||     |..||.:|:.....|::|:|...||:  .|.:..|..:|.| ...::
Human   690 ARLWIEFESEKGL-----DYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNED 749

  Fly   781 HLELFEFVGRMLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTFIKH 845
            ||..|.|:||:.|.||:.|.::|..|...|...:||:     ...::::.|:|:|.|.||.:|  
Human   750 HLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGK-----QITLNDMESVDSEYYNSLKWI-- 807

  Fly   846 YKQDVSDLNLTFSVDQDVMGKIVTLALHPGGKARVVNDHNKLVYIHYMAFFHMNTQIREQTIAFN 910
            .:.|.::|:|.|.:|::..|:...:.|.|.|...:|.:.||..||..:..:....::::|..||.
Human   808 LENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFL 872

  Fly   911 RGFRSIVNPEWLSLFSPPELQRLISGDTSPLDLKDLQKHTHYYGGFHDTHQVVCWLWD-ILAKDF 974
            .||..::..:.:.:|...||:.|:.| ...:|:.|.::|:.|..|:...|.|:.|.|. :|..| 
Human   873 EGFTELLPIDLIKIFDENELELLMCG-LGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMD- 935

  Fly   975 TEEERKLFLKFVTSCSKPPLLGFAHLEPPFSIRCVEVSDDEDTGDTIGSVIRGFFAIRKKDPLNR 1039
             .|:|...|:|||..|:.|:.|||.|                    .||.....|.|.:.....:
Human   936 -AEKRIRLLQFVTGTSRVPMNGFAEL--------------------YGSNGPQLFTIEQWGSPEK 979

  Fly  1040 LPTSSTCFNLLKLPNYQKKSTLRDKLRYAVSSNTGFE 1076
            ||.:.||||.|.||.|:....||:||..||.:..|||
Human   980 LPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFE 1016

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 114/386 (30%)
HECTc 718..1075 CDD:214523 106/360 (29%)
NEDD4LXP_006722489.1 C2_NEDD4_NEDD4L 21..179 CDD:175999
WW 224..250 CDD:278809
WW 413..442 CDD:278809
WW 526..556 CDD:238122
WW 575..625 CDD:197736
HECTc 662..1016 CDD:238033 114/388 (29%)
HECTc 686..1015 CDD:214523 107/363 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.