DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and yap-1

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_001369894.1 Gene:yap-1 / 181267 WormBaseID:WBGene00008748 Length:442 Species:Caenorhabditis elegans


Alignment Length:201 Identity:39/201 - (19%)
Similarity:67/201 - (33%) Gaps:56/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   659 IPHEDRVKLFRKFVQNEKAVMGLTESACASPRSALIVIHRDRIVEDGYRQLAAQPTQALKGVIRV 723
            :||.....:..   |:.|:|..|..:...||    :..|                   :|.|...
 Worm   121 VPHPSHHNVHH---QHSKSVSALPMTIGYSP----VPSH-------------------VKSVSHE 159

  Fly   724 RFINQQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFKTTSDQRLYPSP-----------ISYV 777
            ...:..||.|.. .|.|:.::..|:::.  .||....|.|..|....|.|           :.|.
 Worm   160 ANYSYAGLSEIP-QQQGMMQQNREKSLS--LDPMRRPFMTPQDVEQLPMPQGWEMCYDSDGVRYF 221

  Fly   778 QDNHLELFEFVGRMLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTF 842
            :|::.:...:....|.:....|         |.|.:.:||.:  ..:|.|     :....|||..
 Worm   222 KDHNSKTTTWDDPRLKQQEQTG---------FGLGENIGQNR--YNNCYD-----NGHSSRSLPS 270

  Fly   843 IKHYKQ 848
            |..::|
 Worm   271 IHQHQQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 31/166 (19%)
HECTc 718..1075 CDD:214523 30/142 (21%)
yap-1NP_001369894.1 WW 206..236 CDD:238122 3/29 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.