Sequence 1: | NP_648279.1 | Gene: | CG5087 / 39035 | FlyBaseID: | FBgn0035953 | Length: | 1078 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001369894.1 | Gene: | yap-1 / 181267 | WormBaseID: | WBGene00008748 | Length: | 442 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 39/201 - (19%) |
---|---|---|---|
Similarity: | 67/201 - (33%) | Gaps: | 56/201 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 659 IPHEDRVKLFRKFVQNEKAVMGLTESACASPRSALIVIHRDRIVEDGYRQLAAQPTQALKGVIRV 723
Fly 724 RFINQQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFKTTSDQRLYPSP-----------ISYV 777
Fly 778 QDNHLELFEFVGRMLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTF 842
Fly 843 IKHYKQ 848 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5087 | NP_648279.1 | HECTc | 694..1076 | CDD:238033 | 31/166 (19%) |
HECTc | 718..1075 | CDD:214523 | 30/142 (21%) | ||
yap-1 | NP_001369894.1 | WW | 206..236 | CDD:238122 | 3/29 (10%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |