DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5087 and PLEKHA7

DIOPT Version :9

Sequence 1:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster
Sequence 2:XP_024304124.1 Gene:PLEKHA7 / 144100 HGNCID:27049 Length:1365 Species:Homo sapiens


Alignment Length:402 Identity:68/402 - (16%)
Similarity:128/402 - (31%) Gaps:136/402 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 RRPFTPPKHWLI--PEVKPSTFIN--------------DLEKAKRNAMLLLAKMPHIIP------ 660
            |||.||.:...:  |:.:.|..|:              :.....|.:|..:..|.|.:.      
Human   585 RRPHTPAERVTVKPPDQRRSVDISLGDSPRRARGHAVKNSSHVDRRSMPSMGYMTHTVSAPSLHG 649

  Fly   661 ---------------HEDRVKLFRKFVQNEKAVMGLTESACASPRS-----------ALIVIHRD 699
                           |:.::...|.|..::.....||...|.:..:           .|.:.:.:
Human   650 KSLEELSLLLTRLRRHQAKLASVRNFAISQLLQHQLTFPTCQADDTYLQLKKDLEYLDLKIKNNE 714

  Fly   700 RIVEDGYRQL-----AAQPTQALKG--VIRVRFINQQGLHEAGID--------QDGVFKEFLEET 749
            .::...|:.|     ..:|.:::.|  :::.|.:....:.|:..|        ||.|.:: ||:.
Human   715 PLINVLYKVLKKSARGCRPRRSMTGRDLLKDRSLKPVKIAESDTDVKLSIFCEQDRVLQD-LEDK 778

  Fly   750 IKKVFDPSLNLFKTTSDQRLYPSPISYVQDNHLELFEFVGRMLGKAVYEGIVVDVPFASFFLSQL 814
            |:.:        |...||.   ..:..|....:|.:....:.|.|..|:             .:|
Human   779 IRAL--------KENKDQL---ESVLEVLHRQMEQYRDQPQHLEKIAYQ-------------QKL 819

  Fly   815 LGQTQQALYSCMDELPSLDNELYRSLTFIKHYKQDVSDLNLTFSVDQDVMGKIVTLALHPGGKAR 879
            |   |:.|.....||.....|:..:.......:.||..|..|..                     
Human   820 L---QEDLVHIRAELSRESTEMENAWNEYLKLENDVEQLKQTLQ--------------------- 860

  Fly   880 VVNDHNKLVYIHYMAFFHMNTQIREQT---------IAFNR-GFR----SIVNPE--WLSLFSPP 928
              ..|.:..      ||...:||::..         ::.|: .||    |:.|||  .:.||..|
Human   861 --EQHRRAF------FFQEKSQIQKDLWRIEDVTAGLSANKENFRILVESVKNPERKTVPLFPHP 917

  Fly   929 ELQRLISGDTSP 940
            .:..|.:.::.|
Human   918 PVPSLSTSESKP 929

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5087NP_648279.1 HECTc 694..1076 CDD:238033 49/278 (18%)
HECTc 718..1075 CDD:214523 46/249 (18%)
PLEKHA7XP_024304124.1 WW 11..40 CDD:306827
WW 56..85 CDD:306827
PH_PEPP1_2_3 159..281 CDD:270068
NESP55 <299..460 CDD:115071
DUF1640 779..905 CDD:311647 29/181 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.