DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5280 and C22orf23

DIOPT Version :9

Sequence 1:NP_648278.1 Gene:CG5280 / 39033 FlyBaseID:FBgn0035952 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005261838.1 Gene:C22orf23 / 84645 HGNCID:18589 Length:227 Species:Homo sapiens


Alignment Length:206 Identity:62/206 - (30%)
Similarity:110/206 - (53%) Gaps:29/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VQYSKETADLIRLLVKESKMSMLVRKQIDESLRNGEPLPLPEPPRPNTNNDPDKETLA------I 115
            :.|:..|.:|:|:::||||::.:.::.|.:.::.|:.|||...|..:....|.|:..:      |
Human    23 ITYTPGTCELLRVMMKESKLTNIQQRHIMDIMKRGDALPLQCSPTSSQRVLPSKQIASPIYLPPI 87

  Fly   116 LDRARNAKRKNLR---QIEASGAYKQSYYRPPADNRMHGEKAKSQLQFTMA-GTHLPDPAIKPRR 176
            |     |.|.:||   ..:|:|||.:..::|.|...:  ||.|.:||...| |..:.:   :.|:
Human    88 L-----AARPHLRPANMCQANGAYSREQFKPQATRDL--EKEKQRLQNIFATGKDMEE---RKRK 142

  Fly   177 RP--REEQLVTEEDLINELLDQINERAEWLTEMESMGQGKKYR----PEIRDQIAERLRRI--QA 233
            .|  |::....|.|...||:.:|.||.|:|.:||::||||:||    .|| .|:.|..|::  ..
Human   143 APPARQKAPAPELDRFEELVKEIQERKEFLADMEALGQGKQYRGIILAEI-SQVGETTRKVGRGR 206

  Fly   234 LESKMKMKSNG 244
            .:.:::|:..|
Human   207 AQRQVRMEIQG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5280NP_648278.1 UPF0193 40..241 CDD:283026 60/201 (30%)
C22orf23XP_005261838.1 UPF0193 6..194 CDD:283026 57/181 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160126
Domainoid 1 1.000 86 1.000 Domainoid score I8142
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5166
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52348
OrthoDB 1 1.010 - - D1195866at2759
OrthoFinder 1 1.000 - - FOG0007385
OrthoInspector 1 1.000 - - oto90899
orthoMCL 1 0.900 - - OOG6_106698
Panther 1 1.100 - - LDO PTHR28348
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.900

Return to query results.
Submit another query.