DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5280 and si:dkey-43k4.3

DIOPT Version :9

Sequence 1:NP_648278.1 Gene:CG5280 / 39033 FlyBaseID:FBgn0035952 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_017212019.1 Gene:si:dkey-43k4.3 / 795882 ZFINID:ZDB-GENE-120215-146 Length:218 Species:Danio rerio


Alignment Length:186 Identity:53/186 - (28%)
Similarity:95/186 - (51%) Gaps:14/186 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 QYSKETADLIRLLVKESKMSMLVRKQIDESLRNGEPLPL---PEPPRPNTNNDPDKE---TLAIL 116
            ||..:|..||:|:::||:::...::||:..|:||..||:   ..|..|||.::....   ||...
Zfish    25 QYRTDTRQLIKLMMQESRLTDFQQRQINNKLKNGGALPITFYSSPLEPNTPSETRVTRVGTLVGQ 89

  Fly   117 DRARNAKRKNLRQIEASGAYKQSYYRPPADNRMHGEKAKSQLQFTMAGTHLPDPAIKPRRRPREE 181
            .:.|:|:|     ..|...||:..:.|.|...:..||.|.|   .:..|...|......:|...|
Zfish    90 QQKRSAER-----CRAGDNYKREQFLPSAARDLEKEKRKLQ---NLLSTGQKDAGPTHSQRESTE 146

  Fly   182 QLVTEEDLINELLDQINERAEWLTEMESMGQGKKYRPEIRDQIAERLRRIQALESK 237
            :.....|...|:||:|.:|.::|.||.|:|:|.:|:..|..:|::::..::.::.|
Zfish   147 RREQPVDRFQEVLDEIEDRRQFLEEMMSLGKGHQYQQLINTEISQKICELEEIDKK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5280NP_648278.1 UPF0193 40..241 CDD:283026 53/186 (28%)
si:dkey-43k4.3XP_017212019.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596448
Domainoid 1 1.000 80 1.000 Domainoid score I8574
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5212
OMA 1 1.010 - - QHG52348
OrthoDB 1 1.010 - - D1195866at2759
OrthoFinder 1 1.000 - - FOG0007385
OrthoInspector 1 1.000 - - oto40683
orthoMCL 1 0.900 - - OOG6_106698
Panther 1 1.100 - - LDO PTHR28348
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.