DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5280 and c22orf23

DIOPT Version :9

Sequence 1:NP_648278.1 Gene:CG5280 / 39033 FlyBaseID:FBgn0035952 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_031756946.1 Gene:c22orf23 / 100485066 XenbaseID:XB-GENE-971971 Length:224 Species:Xenopus tropicalis


Alignment Length:202 Identity:68/202 - (33%)
Similarity:117/202 - (57%) Gaps:16/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PGGAGAFHSAK-VQYSKETADLIRLLVKESKMSMLVRKQIDESLRNGEPLPLPEPPRPNTNNDPD 109
            |.|.|.:::|| .||||||.:|||::::|||::...::||.|.|:.|:.||:  ...|::.:...
 Frog    11 PVGTGFWNNAKPAQYSKETQELIRVMMEESKLTNFQKRQIKERLQGGDALPV--QCHPSSTDSGS 73

  Fly   110 KETLAILDRARNAK----RKNLRQIE---ASGAYKQSYYRPPADNRMHGEKAKSQLQFTMA-GTH 166
            |...|.:.:...|.    |..||..|   |..||.:..::|.....::.||.:  ||..|| |..
 Frog    74 KRAAAAISQRPKATLQPCRPRLRPAEKCRAGDAYCRDKFQPRPTRDLNKEKCR--LQNIMATGKD 136

  Fly   167 LPDPA-IKPRRRPREEQLVTEEDLINELLDQINERAEWLTEMESMGQGKKYRPEIRDQIAERLRR 230
            ||.|. :.|::...||:  .|:|..:||:.::.||.::|.|||::|:||.||..|..:|:::||.
 Frog   137 LPAPTRVIPQKENWEEE--GEKDRFDELVAEVQERWDFLEEMEALGKGKDYRNIINTEISQKLRE 199

  Fly   231 IQALESK 237
            ::.::.:
 Frog   200 MEIIDKQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5280NP_648278.1 UPF0193 40..241 CDD:283026 68/202 (34%)
c22orf23XP_031756946.1 UPF0193 7..215 CDD:398769 68/202 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7143
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I4899
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195866at2759
OrthoFinder 1 1.000 - - FOG0007385
OrthoInspector 1 1.000 - - oto104683
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.