DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and EAT1

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_011529.1 Gene:EAT1 / 852898 SGDID:S000003247 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:28/108 - (25%)
Similarity:48/108 - (44%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YRTKQPE--------KPGPVLLLLHG--GGYSALTWAHFCSEVTS-MIHCQCLCIDMRGHGDSKV 115
            :||:.|.        :..|.::.:||  |.:   ...|..:::.| .:......:|:|.||.|..
Yeast    21 HRTRLPSDVSSLIKFEQRPAIINIHGLLGSH---VMFHSLNKLLSRKLDADIFSVDVRNHGISPK 82

  Fly   116 DDEDDLSADTLAKDIGDLILKLYPEEVPQLFVVGHSMGGAIAV 158
            ....|.:  ||..|:...|......|.| ::::|.||||.||:
Yeast    83 AIPYDYT--TLTNDLIYFIETHIGLERP-IYLLGFSMGGKIAL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 25/92 (27%)
Abhydrolase_5 73..>161 CDD:289465 24/89 (27%)
EAT1NP_011529.1 Abhydrolase_1 39..309 CDD:395444 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.