DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and ABHD11

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_024302717.1 Gene:ABHD11 / 83451 HGNCID:16407 Length:434 Species:Homo sapiens


Alignment Length:356 Identity:79/356 - (22%)
Similarity:117/356 - (32%) Gaps:132/356 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IYRTKQPEKPGPVLLLLHG---GGYSALT-WAHFCSEVTSMIHCQCLCIDMRGHGDSKVDDEDDL 121
            |.|...|.:|.   |...|   |..|:|. |.            |.|.:|.|.||||  ....|:
Human   186 ILRDCHPARPA---LQRRGHNPGACSSLAEWP------------QVLTVDARNHGDS--PHSPDM 233

  Fly   122 SADTLAKDIGDLILKLYPEEVPQL-----FVVGHSMGGAIAVHFA--HMALVPNLIGITVIDVVE 179
            |.:.:::|:.||:        |||     .||||||||..|:..|  ...||..||.:. |..||
Human   234 SYEIMSQDLQDLL--------PQLGLVPCVVVGHSMGGKTAMLLALQRPELVERLIAVD-ISPVE 289

  Fly   180 GTAMEALASMQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATNDLP 244
            .|.:...|:..:.:|:                            :::..::......|||     
Human   290 STGVSHFATYVAAMRA----------------------------INIADELPRSRARKLA----- 321

  Fly   245 LPDDVLEEAHHNSMFPNPFSISEDEESSPPGDDAADGSSESAAAGADFKKPNTTKSTTEAAKNYT 309
                                   ||:.|....|.|             .:.:...:..|....:.
Human   322 -----------------------DEQLSSVIQDMA-------------VRQHLLTNLVEVDGRFV 350

  Fly   310 WRIDLSKSEKYWVGWFSGLSDKFLNLRLPKQLLLASIDGLDRTLTVGQMQ--------------G 360
            ||::|....::        .||.|.....::..|    |....|..|..|              .
Human   351 WRVNLDALTQH--------LDKILAFPQRQESYL----GPTLFLLGGNSQFVHPSHHPEIMRLFP 403

  Fly   361 RFQMQVLARCGHAVHEDRPHEVAEVISGYLI 391
            |.|||.:...||.:|.|||.:....|.|:|:
Human   404 RAQMQTVPNAGHWIHADRPQDFIAAIRGFLV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 43/144 (30%)
Abhydrolase_5 73..>161 CDD:289465 31/96 (32%)
ABHD11XP_024302717.1 Atrophin-1 <15..159 CDD:331285
PRK10673 216..433 CDD:331147 67/308 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.