DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and abhd11

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_031751952.1 Gene:abhd11 / 779475 XenbaseID:XB-GENE-952690 Length:337 Species:Xenopus tropicalis


Alignment Length:424 Identity:84/424 - (19%)
Similarity:136/424 - (32%) Gaps:150/424 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RIG--------RADSFKKSRIRDYKPGM-------WNEFFAEK---------EDVTVDEQ-RTFR 60
            |||        ||.||.|.|...::...       |..|::..         :..|.|:. ...|
 Frog     7 RIGSKSRPSVQRAVSFSKVRALIFQGSKGWHLWQHWRAFYSSSASGNGKLCCQTGTTDKNTHATR 71

  Fly    61 I----YRTKQPEKPGPVLLLLHG--GGYSALTWAHFCSEVTSMIH---CQCLCIDMRGHGDSKVD 116
            :    |.......|||.|:||||  |..|     :|.|...:::.   .:.|.:|.|.||.|..|
 Frog    72 VVDLSYDLYDGSAPGPPLVLLHGLFGSKS-----NFQSIARALVRKTGRKVLTLDARNHGCSPHD 131

  Fly   117 DEDDLSADTLAKDIGDLILKLYPEEVPQLFVVGHSMGG--AIAVHFAHMALVPNLIGITV--IDV 177
              |.::...::.|:..::.||   ::....::||||||  |:.|......||..|:.:.:  ...
 Frog   132 --DIMTYPAMSADVCQILHKL---QITSCVLIGHSMGGKTAMTVALQEPKLVERLVSVDISPAPT 191

  Fly   178 VEGTAM-EALASMQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATN 241
            |..|.. ..:|:||                                ||.:.|:|...|..:||..
 Frog   192 VPQTGFPHYIAAMQ--------------------------------KVHLEGKIPRSTARRLAEE 224

  Fly   242 DLPLPDDVLEEAHHNSMFPNPFSISEDEESSPPGDDAADGSSESAAAGADFKKPNTTKSTTEAAK 306
            .|                                     .|:...|:...|...|..:..    .
 Frog   225 QL-------------------------------------SSTVKEASIRQFLLTNLVQEN----G 248

  Fly   307 NYTWRIDLSKSEKYWVGWFSGLSD--KFLNLRLP---KQLLLASIDG----------LDRTLTVG 356
            .:.||::|....::       |.|  .|...:.|   ..|.|...:.          ::|.....
 Frog   249 TFKWRVNLEVISQH-------LQDLLDFPEFQEPYPGPALFLGGANSPYISSENYPEIERLFPCA 306

  Fly   357 QMQGRFQMQVLARCGHAVHEDRPHEVAEVISGYL 390
            .::..|      ..||.||.|:.|:....|..::
 Frog   307 NVEYIF------GAGHWVHADKTHDFLNSICNFV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 39/143 (27%)
Abhydrolase_5 73..>161 CDD:289465 28/94 (30%)
abhd11XP_031751952.1 PRK10673 87..336 CDD:182637 67/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.