DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and Ephx3

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001028335.1 Gene:Ephx3 / 71932 MGIID:1919182 Length:424 Species:Mus musculus


Alignment Length:333 Identity:75/333 - (22%)
Similarity:119/333 - (35%) Gaps:87/333 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GPVLLLLHGGGYSALTWAHFCSEVTSMIHCQCLCIDMRGHGDSKVDDE-DDLSADTLAKDIGDLI 134
            ||::|.|||...:..:|.:...|..|  |...:.:||||:..|....| |..:.|.|..||.|.|
Mouse   161 GPLMLFLHGFPENWFSWRYQLREFQS--HFHVVAVDMRGYSPSDAPKEVDCYTIDLLLDDIKDTI 223

  Fly   135 LKLYPEEVPQLFVVGHSMGGAIAVHFA--HMALVPNLIGITVIDVVEGTAMEALASMQSFLRSRP 197
            |.|   ...:..:|.|..|.::|..|:  :.:||..::      |..|..|..            
Mouse   224 LGL---GYSKCILVSHDWGASLAWEFSIYYPSLVERMV------VANGPPMSV------------ 267

  Fly   198 KYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATNDLP-LPDDVLEEAHHNSMFPN 261
                         |:...:.::        |||..  :|.:....|| ||:.:|      ||  :
Mouse   268 -------------IQEYSIHHI--------GQIFR--SNYMFLFQLPWLPEKLL------SM--S 301

  Fly   262 PFSISED----EESSPPGDDAADGSSESAAAGADFKKPNTTKSTTEAAKNYTWRIDLSKSEKYWV 322
            .|.|.:|    .::..||..    .||..|....|.:|..                |:....|:.
Mouse   302 DFQILKDTFTHRKNGIPGLT----PSELEAFLYHFSQPGC----------------LTGPINYYR 346

  Fly   323 GWFSGLSDKFLNLRLPKQLLLASID-----GLDRTLTVGQMQGRFQMQVLARCGHAVHEDRPHEV 382
            ..|.....:...|..|..||....|     ||...:....:.||.:..:|...||.:.:..|.|:
Mouse   347 NVFRNFPLEPKKLSTPTLLLWGEKDFAFQQGLVEAIGRHFVPGRLESHILPGSGHWIPQSHPQEM 411

  Fly   383 AEVISGYL 390
            .:.:..:|
Mouse   412 HQYMWAFL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 35/135 (26%)
Abhydrolase_5 73..>161 CDD:289465 27/88 (31%)
Ephx3NP_001028335.1 Abhydrolase 139..>262 CDD:304388 33/111 (30%)
MhpC 144..415 CDD:223669 74/327 (23%)
Abhydrolase <341..424 CDD:304388 17/79 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.