DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and ephx2

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001008642.1 Gene:ephx2 / 494099 ZFINID:ZDB-GENE-041212-70 Length:557 Species:Danio rerio


Alignment Length:347 Identity:70/347 - (20%)
Similarity:123/347 - (35%) Gaps:85/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GPVLLLLHGGGYSALTWAHFCSEVTSMIHC--QCLCIDMRGHGDSKV-DDEDDLSADTLAKDIGD 132
            ||.:||.||...|..:|.:   ::.::...  :.|..||:|:|.|.. .|.::.|.:.:..|:..
Zfish   254 GPPVLLCHGFPESWFSWRY---QIPALADAGFRVLAPDMKGYGGSTAPPDIEEYSQEQIMLDLVT 315

  Fly   133 LILKLYPEEVPQLFVVGHSMGGAIAVHFA--HMALVPNLIGIT--VIDVVEGT-AMEALASMQSF 192
            .:.|:   .:.|:.:|||..||.:..:.|  |...|..:..:.  :..|...| .||.|.::..|
Zfish   316 FLDKM---AIAQVTLVGHDWGGVLVWNMAQFHPERVRAVASLNTPLFPVDPNTNPMEKLMAIPIF 377

  Fly   193 LRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATNDLPLPDDVLEEAHHNS 257
              ....|||.                        ||         :|..:|        |.:...
Zfish   378 --DYQIYFQK------------------------PG---------VAEAEL--------EKNLKR 399

  Fly   258 MFPNPFSISEDEESSPPGDDAADGSSESAAAGADFKKPNTTKSTTEAAKNYT-------WRIDLS 315
            .|...|..|.|....|....|..........|:....|.::..:..|.:.||       :|..|:
Zfish   400 TFKLMFISSSDTGGFPKLSPAGVCQRGGLFVGSPDDPPRSSMLSVSALQFYTEQYSKSGFRGPLN 464

  Fly   316 KSEKYWVGWFSGLSDKFLNLRLPKQLLLASID---------GLDR---TLTVGQMQGRFQMQVLA 368
            ....|...|...:|.....:.:|..::.|..|         |::.   .|:.|.::         
Zfish   465 WYRNYERNWRWMVSRPRAKILMPALMVTAGKDPVLLPAFATGMENLIPNLSRGHIE--------- 520

  Fly   369 RCGHAVHEDRPHEVAEVISGYL 390
            .|||....:||.|:.:::..:|
Zfish   521 ECGHWTQMERPAELNKILISWL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 36/140 (26%)
Abhydrolase_5 73..>161 CDD:289465 22/90 (24%)
ephx2NP_001008642.1 HAD-1A3-hyp 3..217 CDD:274054
HAD_like <155..203 CDD:304363
Abhydrolase 237..>358 CDD:304388 27/109 (25%)
Abhydrolase_1 255..531 CDD:278959 65/333 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.