DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and serhl

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_031755888.1 Gene:serhl / 493433 XenbaseID:XB-GENE-5751959 Length:309 Species:Xenopus tropicalis


Alignment Length:121 Identity:27/121 - (22%)
Similarity:48/121 - (39%) Gaps:31/121 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KPGPVLLLLHGGGYSALTWAHFCSEVTSMIHC-----QCLCIDMRGHGDSKVDDEDDLSADT--- 125
            :.|.::|.|||       |....:....:|..     ..:.:|..|||         ||:..   
 Frog    31 REGQLVLCLHG-------WLDNANSFNKLIPLLPQGYHYVALDFTGHG---------LSSHKPPG 79

  Fly   126 LAKDIGDLILKLYPEEV----PQLFVVGHSMGGAIAVHFAHMALVPNLI-GITVID 176
            ...|..|.::..|...|    .::.|:|||:||.:....|  ::.|.:| .:.::|
 Frog    80 ARYDFIDFVIDAYKALVALGREKVTVLGHSLGGLVGTLLA--SIYPEIIENVILLD 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 27/120 (23%)
Abhydrolase_5 73..>161 CDD:289465 22/99 (22%)
serhlXP_031755888.1 Abhydrolase_1 35..>134 CDD:395444 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.