DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and abhd10b

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001373402.1 Gene:abhd10b / 492622 ZFINID:ZDB-GENE-041111-196 Length:289 Species:Danio rerio


Alignment Length:219 Identity:54/219 - (24%)
Similarity:82/219 - (37%) Gaps:62/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YRTKQPEKPGPVLLLLHG---GGYSALTWAHFCSEVTSMIHCQCLCIDMRGHGDSK-VDDEDDLS 122
            ||..:.:.||.|.|..:|   .|..|.....||.   |:.|.. |..|..|||.|: |..|..:.
Zfish    52 YRRVKGKSPGVVFLPGYGSNMSGPKAEALEEFCK---SLGHAY-LRFDYSGHGASEGVFSEGTIG 112

  Fly   123 ADTLAKDIGDLILKLYPEEVPQLFVVGHSMGG--AIAVHFAHMALVPNLIGITVIDVVEGTAMEA 185
              |..||:..::.:|  .|.||: :||.||||  .:....|.......|:||:       ||.:.
Zfish   113 --TWKKDVLFMLDEL--AEGPQI-LVGSSMGGWLMLLAAIARPEKTKALVGIS-------TAADH 165

  Fly   186 LASMQSFLRSRPKYFQSIPNAIE--------WCIRSGQVRNVDSAKVSMPGQIINCTTNKLATND 242
            ..:.          |:::|..:.        |.|         ..|.:..|..   |.|.     
Zfish   166 FVTA----------FKALPIEVRKECEDKGIWTI---------PTKSNQEGIY---TVNM----- 203

  Fly   243 LPLPDDVLEEAHHNSMFPNPFSIS 266
                 |.|:||.::.:..:|..|:
Zfish   204 -----DFLQEAENHCILQSPIPIT 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 39/139 (28%)
Abhydrolase_5 73..>161 CDD:289465 30/93 (32%)
abhd10bNP_001373402.1 MhpC 49..266 CDD:223669 54/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.