DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and abhd11

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001004290.1 Gene:abhd11 / 446169 ZFINID:ZDB-GENE-040909-1 Length:317 Species:Danio rerio


Alignment Length:406 Identity:82/406 - (20%)
Similarity:143/406 - (35%) Gaps:112/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSLQRTMLKGKLPPTIPGGRIGRADSFKKSRIRDYKPGMWNEFFAEKEDVTVDEQR-------T 58
            ||:|.|...:        |...|.:.....:.:||:..|:     :..:....|..|       |
Zfish     6 MSALCRVFTR--------GAPCGLSSCSSVTGLRDFCSGV-----SRLDRAGSDSMRTASPVNLT 57

  Fly    59 FRIYRTKQPEKPGPVLLLLHG--GGYSALTWAHFCSEVTSMIH---CQCLCIDMRGHGDSKVDDE 118
            :.::..|....|   |:.|||  |..|     :|.|...|::.   .:.|.||.|.||  |....
Zfish    58 YDVFDGKGDSTP---LVFLHGLFGSKS-----NFHSIAKSLVQRTGRKVLTIDARNHG--KSPHS 112

  Fly   119 DDLSADTLAKDIGDLILKLYPEEVPQLFVVGHSMGGAIAVHFAHMALVPNLI-GITVIDVVEGTA 182
            ..|:.||:..|:..|:.:|:   :.:..::||||||.:|:..|  ...|||: .:.|:|:     
Zfish   113 PVLTYDTMTSDLTHLLGQLH---IGKCVLIGHSMGGKVAMTTA--LSQPNLVERLVVVDI----- 167

  Fly   183 MEALASMQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATNDLPLPD 247
            ..:|.|..:...:   |.|::                  .:|.:|..|...|..:||.:.|   .
Zfish   168 SPSLTSAHTNFHA---YIQAM------------------KEVKIPSDIPRSTARRLAEDQL---R 208

  Fly   248 DVLEEAHHNSMFPNPFSISEDEESSPPGDDAADGSSESAAAGADFKKPNTTKSTTEAAKNYTWRI 312
            .:::|..     ...|.::..||.:                                 ..|.|||
Zfish   209 KIVKERS-----VRQFLLTNLEEQN---------------------------------GQYGWRI 235

  Fly   313 DLSKSEKYWVGWFSGLSDKFLNLRLPKQLLLASIDGLDRTLTVGQMQGRF---QMQVLARCGHAV 374
            :|.....: :....|..:.......|...|..|......:....::|..|   .:|.:....|.:
Zfish   236 NLESISNH-LEDILGFPEFDTTYEGPTLFLGGSSSAYISSDDYPEIQRLFPCADIQYIPDASHWI 299

  Fly   375 HEDRPHEVAEVISGYL 390
            |.|:|.:....|..:|
Zfish   300 HADKPLDFISSIITFL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 40/139 (29%)
Abhydrolase_5 73..>161 CDD:289465 29/92 (32%)
abhd11NP_001004290.1 PRK10673 66..315 CDD:182637 68/331 (21%)
Abhydrolase 70..>157 CDD:304388 30/98 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.