DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and Abhd4

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001102336.1 Gene:Abhd4 / 364380 RGDID:1311858 Length:355 Species:Rattus norvegicus


Alignment Length:370 Identity:66/370 - (17%)
Similarity:125/370 - (33%) Gaps:113/370 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NEFFAEKEDVTVDEQRTFRIYRTKQPEKPGPVLLLLHGGGYSALTWAHFCSEVTS--MIHCQCLC 104
            |:|.|..  |::..|...........:|....|:::||.|.....|......:::  .:|    .
  Rat    54 NKFLARY--VSLPNQNKIWTVTVSPEQKDRTPLVMVHGFGGGVGLWILNMDSLSARRTLH----T 112

  Fly   105 IDMRGHGDSK----------VDDEDDLSADTLAKDIGDLILKLYPEEVPQLFVVGHSMGGAIAVH 159
            .|:.|.|.|.          .:||...|.:|..:.:|          :|.:.::|||:||.:|..
  Rat   113 FDLLGFGRSSRPTFPRDPEGAEDEFVTSIETWRETMG----------IPTMILLGHSLGGFLATS 167

  Fly   160 FA--HMALVPNLIGITVIDVVEGTAMEALASMQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSA 222
            ::  :...|.:||      :|:........:..|.:|:.|.:.:::.:.:.   ||..:..:..|
  Rat   168 YSIKYPERVKHLI------LVDPWGFPLRPTDPSEIRTPPTWVKAVASVLG---RSNPLAVLRVA 223

  Fly   223 KVSMPGQIINCTTN-KLATNDLPLPDDVLEEAHHNSMFPNPFSISEDEESSPPGDDAADGSSESA 286
            ....||.:.....: |....|....|.:.|..:|.:            ..:|.|:.|.....|| 
  Rat   224 GPWGPGLVQRFRPDFKRKFADFFEDDTISEYIYHCN------------AQNPSGETAFKAMMES- 275

  Fly   287 AAGADFKKPNTTKSTTEAAKNYTW-------RIDLSKSE---------KYWVGWFSGLSDKFLNL 335
                                 :.|       ||.|.:.:         ..|:...:|        
  Rat   276 ---------------------FGWARRPMLERIHLIRKDVPITMIYGANTWIDTSTG-------- 311

  Fly   336 RLPKQLLLASIDGLDRTLTVGQMQGRFQMQVLARCGHAVHEDRPH 380
               |::.|...|...|.:   :::|         ..|.|:.|:||
  Rat   312 ---KKVKLQRPDSYVRDM---EIEG---------ASHHVYADQPH 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 29/147 (20%)
Abhydrolase_5 73..>161 CDD:289465 22/99 (22%)
Abhd4NP_001102336.1 PLN02894 24..351 CDD:215484 66/370 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.