DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and serhl

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_955909.2 Gene:serhl / 322648 ZFINID:ZDB-GENE-030131-1368 Length:326 Species:Danio rerio


Alignment Length:361 Identity:71/361 - (19%)
Similarity:116/361 - (32%) Gaps:136/361 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GPVLLLLHGGGYSALTWAHFCSEVTSMI-----HCQCLCIDMRGHG-DSKVDDEDDLSADTLAKD 129
            |..:|.|||       ||.......:::     ..:.:.||..||| .|...|....:......|
Zfish    42 GRPVLCLHG-------WADNSGTFNTLVPLLPNDWRFVAIDFPGHGLSSHRPDGCFYAFPFYVAD 99

  Fly   130 IGDLILKLYPEEVPQLFVVGHSMGGAIAVHFAHMALVPNLI-GITVIDV-----VEGTAMEALAS 188
            :..::..|   :..:..::||||||.:|..|:  ||.|.:: .:.::|.     .|.|.|  ..:
Zfish   100 VRRVVEAL---QWKRFSIIGHSMGGNVAGMFS--ALYPEMVESVVLLDTYGFLPTEVTDM--FTN 157

  Fly   189 MQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATNDLPLPDDVLEEA 253
            |:..:..:.:| .::.|.     |..:|...:.||..:          |:|              
Zfish   158 MRKGINDQIQY-DNMANE-----RKERVYTYEKAKERL----------KVA-------------- 192

  Fly   254 HHNSMFPNPFSISEDEESSPPGDDAADGSSESAAAGADFKKPNTTKSTTEAAKNYTWRIDLSKSE 318
                   ||:.          .|.:||...|.|....|                           
Zfish   193 -------NPYL----------SDQSADILLERAVREVD--------------------------- 213

  Fly   319 KYWVGWFSGLSDKFLNLR-----------------LPKQLLLASIDGLDRTLTV----------- 355
                |.|....|..:||:                 ..|.:||.:.|||.:|.|:           
Zfish   214 ----GGFVFTRDFRINLKNIIYINIDQCLHVLSQVKAKVMLLLAKDGLFKTFTLPDGYADRICKS 274

  Fly   356 -GQMQGRFQMQVLARCGHAVHEDRPHEVAEVISGYL 390
             ...:..|   |.....|.||.:.|..|:.||:.:|
Zfish   275 WTDQKATF---VEVEGDHHVHLNNPEAVSSVITDFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 33/144 (23%)
Abhydrolase_5 73..>161 CDD:289465 22/93 (24%)
serhlNP_955909.2 MhpC 35..308 CDD:223669 71/361 (20%)
Abhydrolase_5 44..>144 CDD:289465 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.