DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and Abhd6

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001007681.1 Gene:Abhd6 / 305795 RGDID:1359323 Length:337 Species:Rattus norvegicus


Alignment Length:333 Identity:69/333 - (20%)
Similarity:124/333 - (37%) Gaps:86/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KPG--PVLLLLHGGGYSALTWAHFCSEVTSMIHCQCLCIDMRGHGDSKVDDEDDLSADTLAKDIG 131
            :||  |.:|:|||.......|......:...:|  .:|:||.||..:.....||||.....|.|.
  Rat    67 RPGHKPSVLMLHGFSAHKDMWLSVVKFLPKNLH--LVCVDMPGHEGTTRSSLDDLSIVGQVKRIH 129

  Fly   132 DLILKLYPEEVPQLFVVGHSMGGAIAVHFAHMALVPNLIGITVIDVVEGTAMEALASMQSFLRSR 196
            ..:..|...:.| ..::|.||||.:|..:|  |..|:       ||. ..::...|.:|....:|
  Rat   130 QFVECLKLNKKP-FHLIGTSMGGNVAGVYA--AYYPS-------DVC-SLSLVCPAGLQYSTDNR 183

  Fly   197 PKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATNDLPLPDDVLE-----EAHHN 256
              :.|.: ..:|....:.::..:.|....|...:..|:..:     ..:|..:|:     ...||
  Rat   184 --FVQRL-KELEDSAATQKIPLIPSTPEEMSEMLQLCSYVR-----FKVPQQILQGLVDVRIPHN 240

  Fly   257 SMFPNPFSISEDEESSPPGDDAADGSSESAAAGADFKKPNTTKSTTEAAKNYTWRIDLSK----S 317
            |.:...|.....|:|                                   .|:...::.|    :
  Rat   241 SFYRKLFLEIVSEKS-----------------------------------RYSLHENMDKIKVPT 270

  Fly   318 EKYWVGWFSGLSDKFLNLRLPKQLLLASIDGLDRTLTVGQMQGRFQMQVLARCGHAVHEDRPHEV 382
            :..|     |..|:.|:        ::..|.|.:::|      ..|::||..|||:|..:||.:.
  Rat   271 QIIW-----GKQDQVLD--------VSGADILAKSIT------NSQVEVLENCGHSVVMERPRKT 316

  Fly   383 AEVISGYL 390
            |:::..:|
  Rat   317 AKLVVDFL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 37/135 (27%)
Abhydrolase_5 73..>161 CDD:289465 25/87 (29%)
Abhd6NP_001007681.1 MhpC 51..327 CDD:223669 69/333 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.