DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5068 and SERHL2

DIOPT Version :9

Sequence 1:NP_001261609.1 Gene:CG5068 / 39032 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_024307964.1 Gene:SERHL2 / 253190 HGNCID:29446 Length:341 Species:Homo sapiens


Alignment Length:367 Identity:69/367 - (18%)
Similarity:121/367 - (32%) Gaps:114/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GPVLLLLHGGGYSALTWAHFCSEVTSMI-----HCQCLCIDMRGHG-DSKVDDEDDLSADTLAKD 129
            ||.:|.|||       |....|....:|     ....:.:|..||| .|...........|...:
Human    32 GPPVLCLHG-------WLDNASSFDRLIPLLPQDFYYVAMDFGGHGLSSHYSPGVPYYLQTFVSE 89

  Fly   130 IGDLILKLYPEEVPQLFVVGHSMGGAIAVHF--AHMALVPNLIGI-TVIDVVEGTAMEALAS--- 188
            |..::..|   :..:..::|||.||.:...|  ....:|..||.: |.:.::|...||.|.:   
Human    90 IRRVVAAL---KWNRFSILGHSFGGVVGGMFFCTFPEMVDKLILLDTPLFLLESDEMENLLTYKR 151

  Fly   189 ------MQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKVSMPGQIINCTTNKLATNDLPLPD 247
                  :|......|.:..|:...::..::|....:.:..::     ::...|.|:||.      
Human   152 RAIEHVLQVEASQEPSHVFSLKQLLQRLLKSNSHLSEECGEL-----LLQRGTTKVATE------ 205

  Fly   248 DVLEEAHHNSMFPNPFSISEDEESSPPGDDAADGSSESAAAGADFKKPNTTKSTTEAAKNYTWRI 312
              :|..|                                .|.|..:..|::..|...::|   .:
Human   206 --MEFRH--------------------------------VAQAGLELLNSSDPTDSTSQN---GL 233

  Fly   313 DLSKSEKYWVGWFSGLSDKFLNLRL-----------------------------PKQLLLASIDG 348
            .|::.::  :.|.....| |::..|                             .|:.|...||.
Human   234 VLNRDQR--LAWAENSID-FISRELCAHSIRKLQAHVLLIKAVHGYFDSRQNYSEKESLSFMIDT 295

  Fly   349 LDRTLTVGQMQGRFQMQVLARCGHAVHEDRPHEVAEVISGYL 390
            :..||     :.:||. |.....|.||...|..||.:||.:|
Human   296 MKSTL-----KEQFQF-VEVPGNHCVHMSEPQHVASIISSFL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 34/150 (23%)
Abhydrolase_5 73..>161 CDD:289465 21/95 (22%)
SERHL2XP_024307964.1 MhpC 21..332 CDD:223669 69/367 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.