DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and pkdc

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:241 Identity:52/241 - (21%)
Similarity:83/241 - (34%) Gaps:71/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 PVCHIAESQDRRDAEGGEPIIVLQDLKAMGFRM-KDRLAGLELSDCLLVMKKLAQLHAASL--AA 202
            |:|..|:|      .|.|.:|||:||...||.: |..:...|:..||   ..:|..||..|  ..
Zfish    96 PLCLAAKS------FGEEQLIVLEDLDVAGFPVRKTYVNDAEIKACL---SWIANFHALFLDVTP 151

  Fly   203 QELESSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTN 267
            :.|......:|                    |:|..:: ||::.|                    
Zfish   152 EGLWPIGTYWH--------------------LETRPEE-LEAMSD-------------------- 175

  Fly   268 LFENLKHEINATAAAPNSV--------ICHGDLWVNNIMFRSEPEEVIFFDLQAMRKSSPIFDIL 324
                  .::.|.|...:|:        |.|||..:.|..|..:..:|...|.|.:.....:.|::
Zfish   176 ------QKLKAAAGEIDSILNNCRFKTIVHGDAKLANFCFSKDGLQVASVDFQYVGGGCGMKDVI 234

  Fly   325 HFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEE 370
            :|:.:.......:.....||..|    ..|||..||.......||:
Zfish   235 YFLGSCMDERECEKKAPGLLDYY----FSELRKSLEKKVDFAELEK 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 47/226 (21%)
P-loop_NTPase <357..435 CDD:304359 4/14 (29%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 49/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D832683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.