DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG18765

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:391 Identity:82/391 - (20%)
Similarity:144/391 - (36%) Gaps:88/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 VTVIV----KRQIASLSRR--------QLYRCEEAFSNEINAYRHLAPLLAAHSRHQLFPVCHIA 146
            :.|:|    |||::.|.:.        :|.|..: ||.|.:.:..:.|.|     .:|:      
  Fly    58 IQVLVADNKKRQVSYLIKSPETVPVGLKLPRTGD-FSTERHMFEVVLPAL-----EELY------ 110

  Fly   147 ESQDRRDAEGGEPIIVLQDLKA----------MGFRMKDRLAGLELSDCLLVMKKLAQLHAASLA 201
            ::.| |....|.|:|..: ||:          .|:.:.:.|.||.::....|:.|||..||.: |
  Fly   111 QNSD-RIVHFGPPVIQAK-LKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGT-A 172

  Fly   202 AQELESSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRT 266
            |...::.........|:|....||.|....::......::|.| .||...:......:...:..|
  Fly   173 AYIAKTPGKIRELPKLRENSKSDEETAELKSLYQLRFHESLRS-NDARQYEDKVKSFQKYVKSGT 236

  Fly   267 NLFENLKHEINATAAAPNSVICHGDLWVNNIMFRSEP----EEVIFFDLQAMRKSSPIFDILHFI 327
            .:.:: |...|        ||.:|..|.||::.:.:.    ::.:|......:....::|:...:
  Fly   237 EILDS-KTSFN--------VILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSL 292

  Fly   328 YTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGL 392
            .|:...  :....|..:..|...|.|.|          ..|:.|.:..||..|..|.::..|:..
  Fly   293 LTAPAE--KSSRFDGYVKFYHDQLIENL----------NLLKFLGKKPSLTDLQLDLLKYGHWAF 345

  Fly   393 AIGMWILPAV--TFDPNNLPNL---DVMSEQNLTGKEIKCTQMLTSEYHMRIRELVMEFYELGYL 452
            .....|||.|  .|..|::..|   .|..||                    ||||:......||.
  Fly   346 ETATEILPIVLSDFGNNDIEELFRNPVFGEQ--------------------IRELLPWMENRGYF 390

  Fly   453 Q 453
            :
  Fly   391 E 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 59/288 (20%)
P-loop_NTPase <357..435 CDD:304359 17/82 (21%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 60/301 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.