DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CHKov2

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:460 Identity:117/460 - (25%)
Similarity:180/460 - (39%) Gaps:108/460 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RQLFS----QSKLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVTVIVKR 100
            ::|||    ||.....:|.....::..|.|:||:::|.|:.|....||.     ..|.|:.|:|.
  Fly    12 KELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKDN-----SIEDVSYILKI 71

  Fly   101 QIASLSRRQLYRCEEAFSNEINAYRHLAP----LLAAHSR--------HQLFPVCHIAESQDRRD 153
            .:.....:..:  .|.|..|::.|.||.|    |.|.::.        |..||            
  Fly    72 PLVPEDEKNDF--HEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFP------------ 122

  Fly   154 AEGGEPI----IVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAAS------LAAQELESS 208
               |||:    |:|:||:..|:|..||..|||..:...|:|||||.||||      |...|.:..
  Fly   123 ---GEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIR 184

  Fly   209 SFAFHADHLQEIVYCDEAT-DFYATILDTSVQQALE------------SLGDANADDCLTTPIRL 260
            ...|..:| |:::  ||.. :|....|:...|..||            .|.|.|.:.....|:.|
  Fly   185 ESYFTTEH-QKLL--DEFNINFCMPFLECMQQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLEL 246

  Fly   261 LEELRTNLFENLKHEINATAAAPNSVICHGDLWVNNIMFR----SEPEEVIFFDLQAMRKSSPIF 321
                                    ||:.|||.|.||.||:    ||.|:|.|.|.|..:..:|..
  Fly   247 ------------------------SVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQ 287

  Fly   322 DILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVR 386
            |:|..:.||.:..::....|..:..|.|.|.|.|          ..|.....|.:|.:..:...|
  Fly   288 DLLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHL----------TMLNYNRNAPTLSKFHAHLHR 342

  Fly   387 QVHYGLAIGMWILPAVTFDP---NNLPNLDVMSEQNLTGKEIKCTQMLTSEYHMRIRELVMEFYE 448
            ...:.......:||.|...|   :::.|:...||:.:.   .|....|...|..:|:.::.....
  Fly   343 YSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEEAIA---FKRKMFLLPAYVDQIKVILPWLIN 404

  Fly   449 LGYLQ 453
            .||::
  Fly   405 RGYIR 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 93/330 (28%)
P-loop_NTPase <357..435 CDD:304359 13/80 (16%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 94/344 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.