DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG10550

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:432 Identity:101/432 - (23%)
Similarity:189/432 - (43%) Gaps:56/432 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NAEHLRQLFSQSKLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSE-IVTVIV 98
            |.|:.:.:..:.......|.::...|.::.|:||.|::.||.:....||      ||| .|:.|:
  Fly    24 NEEYFQPIIEKDVENFDKIINLVPIAATAPGENYTSIMIRVIVDILLKD------GSEQRVSYIL 82

  Fly    99 KRQIASLSRRQLYRCEEAFSNEINAYR-HLAPLLAAHSRH----QLFPVC-HIAESQDRRDAEGG 157
            |..:.:.|...:......|..|...|. |:...:..:...    :|.|.| |:       ||...
  Fly    83 KTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHV-------DATDE 140

  Fly   158 EPIIVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSFAFHADHLQEIVY 222
            ...:|.:||....|:..|||.|.:|.....|::|||:|||||:.|:|:.....|.:    ...:|
  Fly   141 LITMVFEDLSRQNFKNFDRLKGFDLPHMREVLRKLAELHAASVVAKEINGPYDAMY----NMSIY 201

  Fly   223 CDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTNLFENLKHEINATAAAPNSVI 287
            .:::.|.:.::.....:|.|:::.:.:.::..:...|:.:.|  .:||... ::|.......:|:
  Fly   202 NEQSRDLFESLGKQREEQFLKAMRNWDLENAESYIARMWDPL--EVFEEAV-QVNQVDEDEFNVL 263

  Fly   288 CHGDLWVNNIMF----RSEPEEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYS 348
            .|||.|.|||||    ..|.:..|..|||..:..||..|:.:.|.||....::....|..:..|.
  Fly   264 NHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLWYLITTSASLDIKIKEFDHFIQIYH 328

  Fly   349 QALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGL-----AIGMWILPAVTFDPNN 408
            |.|:|.|: .|..:.....|.:|            ::..:.||.     |:|:.:...:..|.: 
  Fly   329 QRLAECLK-LLNYSKPIPTLRDL------------HIMMLKYGFWGPLTAMGVMVATLMPTDKD- 379

  Fly   409 LPNLDVMSEQNLTGKEIKCTQMLT--SEYHMRIRELVMEFYE 448
             .|:.::..|   |.|....:..|  :.|:.:..::::.|::
  Fly   380 -ANMKMILAQ---GPEADAIRYRTFINPYYAKAMKVLLPFFD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 82/302 (27%)
P-loop_NTPase <357..435 CDD:304359 13/84 (15%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 83/307 (27%)
APH 108..338 CDD:279908 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.