DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG13659

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:352 Identity:78/352 - (22%)
Similarity:139/352 - (39%) Gaps:67/352 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NAEHLRQ-LFSQSKLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIV-TVI 97
            |.:.:.| |....|..:..:.:::.:..|:.||:|.|::.|..:....  |:.....|.|: |:|
  Fly    18 NVQFMTQVLRGYEKDSNLKVINLSFTPASAKGDHYASIMFRARVEYTA--QNGNFTKSLIIKTMI 80

  Fly    98 VKRQIASLSRRQLYRCEEAFSNEINAYRHLAP-----LLAAHSRHQLFPVCHIAESQDRRDAEGG 157
            |:..|    ::.:::....|:.||..|..:.|     |..|:...:|:..|.....|..:     
  Fly    81 VEEGI----KKDMFKDSPLFTTEIGMYTKVLPEWERILRRANDPAKLYVECIYHSLQPHQ----- 136

  Fly   158 EPIIVLQDLKAMGFR-MKDR-LAGLELSDCLLVMKKLAQLHAASLAAQELESSSFAF-HADHLQE 219
              |::..||..||:. ::|| |...|:|.   ...|||::||.|:        .|.. ..::|:|
  Fly   137 --ILIFDDLVEMGYAVVRDRFLTREEISS---AYSKLAKIHAISM--------KFIHEQPEYLKE 188

  Fly   220 IV--YCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLE-------------ELRTNLF 269
            ..  .|:......::|:...:...:|.||            |:.|             ..:..|.
  Fly   189 FKNGLCEMPGLIDSSIISGGMDPFMEMLG------------RIPELSKYQPHFKKISLHFKDRLR 241

  Fly   270 ENLKHEINATAAAPNSVICHGDLWVNNIMFRSEP-----EEVIFFDLQAMRKSSPIFDILHFIYT 329
            |.::...|......| |:||.|....|:||::..     |:.:..|.|....:....|:::.||.
  Fly   242 ETMQEYRNNPQPGYN-VLCHADFHSRNMMFKNNKETGCFEDCMLLDYQGCNVAPMAVDLMYSIYM 305

  Fly   330 STRRPLRDVHTDTLLAAYSQALSEELR 356
            ......|....|.||..|...|.|.|:
  Fly   306 LMGPAQRREELDILLNYYLSILLETLK 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 73/321 (23%)
P-loop_NTPase <357..435 CDD:304359 78/352 (22%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 73/322 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.