DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG6908

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:409 Identity:105/409 - (25%)
Similarity:164/409 - (40%) Gaps:87/409 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVTVIVKRQIASLSRRQLY 111
            |:.||.:...|     ..|:||.:::.|........|      |||.....:.:.:.:...|:..
  Fly    69 KIKSFRLEPTA-----GKGENYTTLLLRANFELELND------GSEQSISYMAKILPNSGNRENV 122

  Fly   112 RCEEAFSNEINAYRHLAPLLA-----AHSRHQLFPVCHIAESQDRRDAEGGEPIIVLQDLKAMGF 171
            ...:.|..|.|.|....|...     |..:....|  ...|||...|.|    :|||:||...||
  Fly   123 ASWKVFYKERNTYGQYIPEFEQMYKDAGKKISFGP--RYYESQIELDDE----LIVLEDLGKRGF 181

  Fly   172 RMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDEATDFYATILDT 236
            |..||..||::......::||||.||||....||:.|             |.:|......:::| 
  Fly   182 RNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGS-------------YPEEYNQNLCSVVD- 232

  Fly   237 SVQQALES----------LGDANADDCLTTPIRLLEELRTNLFENLKHEINATAAAPNSVICHGD 291
            |:::..|:          |.||:.   ||..::.......::|::...:|....    .|:.|||
  Fly   233 SLKELRENQLKAYIDAFPLYDASH---LTNDVQAYGSQADDMFQSFAPKIEGEF----RVLNHGD 290

  Fly   292 LWVNNIMFRSEP----EEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALS 352
            .|.||||::.:.    .||.|.|||..|.|||..|:|:.|.:||...::....|.|:..|.    
  Fly   291 AWCNNIMYQYDEAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYH---- 351

  Fly   353 EELRHQLEDTTAAERLEELCEAFSLQRLSSDY--VRQVHYGLAI-GMWILPAVT-------FDPN 407
                            |:|.|:..|.:.....  :|.:|..:.| |.||||.|:       .|..
  Fly   352 ----------------EKLIESLKLLKYPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGG 400

  Fly   408 NLPNLDVMSEQNLTGKEIK 426
            :..|:|.:.:....|.:|:
  Fly   401 DDANMDSLMDGEGAGDKIR 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 83/310 (27%)
P-loop_NTPase <357..435 CDD:304359 18/80 (23%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 87/334 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.