DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG13813

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster


Alignment Length:410 Identity:105/410 - (25%)
Similarity:181/410 - (44%) Gaps:75/410 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GDNYMSVVKRV---TISQAGKDQDPELAGSEIVTVIVKRQIASLSRRQLYRCEEAFSNEINAYRH 126
            |:|....|.||   ||..|             .||:||....:.:||......:.::.|:..|:.
  Fly    34 GENAYGQVLRVSWPTIVDA-------------ATVVVKMAPRNEARRSHMHVVDYYAREVFMYQK 85

  Fly   127 LAPLLAAHS-RHQLFPVCHIAESQDRRDAEGGEPIIVLQDLKAMGFRMKDR--LAGLELSDCLLV 188
            :.|:..|.| ....|.|   |.:....|.:..:..::.:||...|||...|  :...::..|.| 
  Fly    86 VFPVFRALSPDRNTFTV---APALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSL- 146

  Fly   189 MKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDA----- 248
             |.||:|||.|...|:.:...|.      |.:.:.::...|.:.|.:.:::.....|..|     
  Fly   147 -KALAELHACSFILQQTDPLQFK------QLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILK 204

  Fly   249 NADDCLTTPIRLLEELRTNLFENLK-HEINATAAAPNSVICHGDLWVNNIMFRSEPE-----EVI 307
            .:|......::.:.:|..|..::|. :.::..|.||::||||||.|.|||::|.||.     |..
  Fly   205 ESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAK 269

  Fly   308 FFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELC 372
            ..|.|..|.:.|:.||:|:::..|.:.|||.|....:.||...:.::|:.              |
  Fly   270 LIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKS--------------C 320

  Fly   373 EAFSLQRL--SSDYVRQVH----YGLAIGMWILPAVTFDPNNLPNLDVMSE--QNLTGKEIKCTQ 429
            . .||:.:  .|.:.||:.    |||.:|.:.||....:.|.:.::|.:||  |:::        
  Fly   321 N-LSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSIS-------- 376

  Fly   430 MLTSEYHMRIRELVMEFYEL 449
              ||....:.:||:.| ||:
  Fly   377 --TSSDEPKYKELIEE-YEM 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 81/308 (26%)
P-loop_NTPase <357..435 CDD:304359 19/85 (22%)
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 81/324 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 1 1.000 - - FOG0002485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.