DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG33510

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:295 Identity:67/295 - (22%)
Similarity:110/295 - (37%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 EINAYRHLAPLLAAHSRHQLFPVCHIAESQDRRDAEGGEPIIVLQDLKAMGF-RMKDRLAGLELS 183
            ||..| .|...|...|:|.....|:..    |:|      :.|:|:::.||: .:......|..:
  Fly   104 EIKLY-DLLNELKKFSKHVWSAKCYFT----RKD------LFVMQNVEDMGYVALPPGTRFLNEN 157

  Fly   184 DCLLVMKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDA 248
            ....::|.||.|||:|:|.::.:..:.........:.|..|...::|.|.|...:..|      |
  Fly   158 QMGPILKSLATLHASSIAYEKQQGKTIGVEFRKWLKEVSVDPEVEWYTTGLRAVLAVA------A 216

  Fly   249 NADDCLTTPIRLLEELRTNLFENLKHEINATAAAPN------SVICHGDLWVNNIMFRSE---PE 304
            ...|.|..|     |.:..:.:.|...::......|      :|..|.|.|..|:.:..|   .|
  Fly   217 IHPDVLDNP-----EAQEYIAQELPRCLDKVYCMVNPSPVHRNVFVHRDAWNANVFYHKEKPHEE 276

  Fly   305 EVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELR--------HQLED 361
            ..|..|.|..|.|.|..|.....|.:.....|.....:|:..|..||:||.|        .||..
  Fly   277 RSILVDFQLCRYSPPAMDFHLVTYLNLEPFSRKKMIGSLIETYYDALAEEFREMGVNPYQEQLSK 341

  Fly   362 TTAAERLEEL--------CEAFSLQRLSSDYVRQV 388
            ....:.|.:.        |.|.::.||..:|::.:
  Fly   342 QEFEQSLNDFSLFGATYNCIAATVLRLPDNYLKNL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 59/254 (23%)
P-loop_NTPase <357..435 CDD:304359 8/40 (20%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 48/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.