DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG33511

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:383 Identity:92/383 - (24%)
Similarity:150/383 - (39%) Gaps:62/383 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IASLSRR---QLYRCEE--AFSNEINAYRHLAPLLAAHSRHQLFPVCHIAESQDRRDAEGGEPII 161
            |.||.|:   |...||.  .|..|...|..:.|.:..::..:|:|.|:.:    |.|      |:
  Fly    68 IKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKKLYPKCYYS----RND------IL 122

  Fly   162 VLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELES-SSFAFHADHLQEIVYCDE 225
            ||:|| ...:|.........|....:|::.|::|||||:|.:|.|: ..:..:.:.|.|: :.|.
  Fly   123 VLEDL-TQDYRHLRANEYYTLDHYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIEL-HLDS 185

  Fly   226 ATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTNLFENLKHEINATAAAPNSVICHG 290
            ...:|.|.|     :|:..|...|...........:::...||....: |:.|.:....:|:||.
  Fly   186 NNSWYITGL-----KAIVFLAARNPHFQTMKAQNFIQDKLYNLLTKAE-ELVAPSKTIRNVLCHR 244

  Fly   291 DLWVNNIM--FRSE----PEEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQ 349
            |.|.:||:  |..|    |......|.|..:..||..|:|..:|......:|....|..|..|.:
  Fly   245 DTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYK 309

  Fly   350 ALSEEL-RHQLEDTTAAE-RLEELCEAFSLQRLSSDYVRQVHYGLAIGMWIL--PAVTFDPNNLP 410
            .|...| |..|:.....| ...:.|:...|              .|:.:|.|  |.....| ::.
  Fly   310 NLQHHLDRLGLDKNLITENNFRKECQRTRL--------------AALVIWALTEPQTKMSP-SIS 359

  Fly   411 NLDVMSEQNLTGKEIKCTQMLTSEYHMRIRELVMEFYE---------LGYLQMQKETL 459
            |.....|.......:.|.:   ||..:|:.|:...:.|         :.|| |:.|.|
  Fly   360 NRLRSEEPEKFDYYLNCDR---SELLLRVIEIQPGYEETIMTPIRELVDYL-MENENL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 69/267 (26%)
P-loop_NTPase <357..435 CDD:304359 13/80 (16%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 70/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.