DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG5126

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:444 Identity:105/444 - (23%)
Similarity:177/444 - (39%) Gaps:72/444 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVTVIVKRQIASLSRRQLYRCEEAFSNE 120
            :.||.|.   |.:||.:..||:...    ..|...:|:  |:||....:...|:.......||||
  Fly    34 VECSNGL---DGFMSALYTVTLDVV----IAERKRTEV--VLVKFMKGTEEFRESSNSYIQFSNE 89

  Fly   121 INAYRHLAP-----LLAAHSRHQL----FPVCHIAE-SQDRRDAEGGEPIIVLQDLKAMGFRMKD 175
            |.||..:.|     |..:|...::    .|.|:.|. ........|.|.::.|:.||..|:::..
  Fly    90 IFAYAEILPAYENVLRTSHLESEVVKNWVPCCYFARFGHVEGLGNGRESVLALKHLKGDGYQLGP 154

  Fly   176 RLAGLELSDCLLVMKKLAQLHAASLAAQELE-----------------SSSFAFHADHLQEIVYC 223
            ||. |.......::..:...||...|.:.|:                 |||.....|.|..:.: 
  Fly   155 RLT-LRRDQLEAMVGLVGPFHALGYATKILQPNVHARLRAGVVDMPFVSSSGKGIFDVLYRVAF- 217

  Fly   224 DEATDFYATILDTSVQQALESLGDA---NADDCLTTPIRLLEELRTNLFENLKHEINATAAAPNS 285
            |...:||....:..:|.|....|.|   ..:.....|..|||.:||:.|         ....|:|
  Fly   218 DRFYEFYDRQKEQLLQGADPGFGAAIERLREKYFKQPTLLLERIRTSSF---------AEDQPDS 273

  Fly   286 ---VICHGDLWVNNIMFRSEPEEVI----FFDLQAMRKSSPIFDILHFIYTST-RRPLRDVHTDT 342
               ...|||...||::|....|:.:    ..|.|.:|.|:...|:..|:|.:| ....::::.| 
  Fly   274 HFATFLHGDYNRNNVLFHYGAEDKVDAIKAIDFQELRFSTTAIDLSFFMYMNTPSEGRKEIYAD- 337

  Fly   343 LLAAYSQALSEEL-------RHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWILP 400
            ||..|.:::.|.|       |::|.|    :|:::|.:.:|.:|.::.:.|...||..:.|..||
  Fly   338 LLRKYHRSMIEMLELVLRRNRNELTD----DRVDQLLQEYSFERFNAHFKRYAFYGPMVCMHFLP 398

  Fly   401 AVTFDPNNLPNLDVMSEQNLTGKEIK--CTQMLTSEYHMRIRELVMEFYELGYL 452
            .:.....:...|..:.|.::.|....  ...:...|.:..|.:.|...||.||:
  Fly   399 WLLGTEKDCAELSRLFETDMHGPAFHQLSLDIAGDEANQEIFKTVRHAYEHGYM 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 79/336 (24%)
P-loop_NTPase <357..435 CDD:304359 15/79 (19%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 79/329 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.