DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG31974

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:397 Identity:78/397 - (19%)
Similarity:163/397 - (41%) Gaps:76/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVTVIVKRQIASLSRR---Q 109
            |.|:|.:::     :..||||.|::..|.......|     .|...:.:|.|  :..|:..   |
  Fly    24 LDSYSTSYL-----TKPGDNYGSIMLSVQAKIRSAD-----GGIRDLPLIAK--LPPLTNDLYWQ 76

  Fly   110 LYRCEEAFSNEINAYRHLAPLLAAHSRHQL------------FPVCHIAE-SQDRRDAE-GGEPI 160
            :::.|.....|...|::|:|.|   .:.||            ||..:.:. |.|.|..: ..:.:
  Fly    77 IFQPERTCITENAVYQYLSPEL---DKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRDAV 138

  Fly   161 IVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDE 225
            :|.:::...|:|..:|.....|::.:|::..|||.||..:|.:..:..            ||.:.
  Fly   139 LVQENVTTRGYRPGNRHRPYNLAETVLILHYLAQYHALPIALRLKKPQ------------VYEEY 191

  Fly   226 ATDFYATI-LDTSVQQA---------LESLGDANADDCLTTPIRLLEELRTNLFENLKHEINATA 280
            ...::... :::::.||         |:.:....:|:   ..:..::|| .::|:..:.. |...
  Fly   192 VRPYFKKFDMNSNIDQAETEIMNKEILKDIKLVTSDE---RDVNRVKEL-LDIFQAFQAS-NDVD 251

  Fly   281 AAPNSVICHGDLWVNNIMFR-------SEPEEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDV 338
            ..|.:.:.|||||:||:|.:       ..|.:|...|.|..:..|.:.||:..:::|....:.:.
  Fly   252 DGPFTTLVHGDLWINNMMLKYGMRGEEGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLED 316

  Fly   339 HTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWILPAVT 403
            :....|..|..|..:.||....||:          .::.:....:..:..|..|...::::..:.
  Fly   317 NFYNFLTIYYNAFIQTLRSVNVDTS----------NYTYELFLEEVQQTAHVQLPHAIFMMKVIL 371

  Fly   404 FDPNNLP 410
            .|.:.:|
  Fly   372 ADNSTIP 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 68/325 (21%)
P-loop_NTPase <357..435 CDD:304359 6/54 (11%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 69/328 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.