DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG7135

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_573269.1 Gene:CG7135 / 32793 FlyBaseID:FBgn0030895 Length:417 Species:Drosophila melanogaster


Alignment Length:435 Identity:111/435 - (25%)
Similarity:180/435 - (41%) Gaps:83/435 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YEENAEH-LRQLFSQSKLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIVT 95
            :....|| |:||..|  ::...:.::     :..|:||.|.:.|..|    |.::.|....| .:
  Fly    17 FRRTLEHGLQQLDLQ--VIGVQLTNL-----TRGGENYCSNIYRAQI----KYRNAESCAME-TS 69

  Fly    96 VIVK----RQIASLSRRQLYRCEEAFSNEINAYRHLAPLLAA--------HSRHQLFPVCHIAES 148
            :|||    .:.|.|:|..:|..|..|      |.|:.|.|.|        .|...|.|..:.:.:
  Fly    70 LIVKSMPDEKQAILARLHIYNKETLF------YMHIKPKLEALMWRAVDSFSAWTLAPKHYYSTT 128

  Fly   149 QDRRDAEGGEPIIVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSS---- 209
            |.       |..|:|:||.|.|:::|.|..||:.....|||.|||:.||.::...|.|..:    
  Fly   129 QP-------EQTIILEDLCAAGYQLKCRQLGLDFDHAALVMAKLAEYHALTMVMAEREPETIVDR 186

  Fly   210 FAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTNLFENLKH 274
            :.|...|:..|     .::.:..:..|.:.:....:||......:||.:....|..|.......:
  Fly   187 YPFGLLHMDAI-----NSEPFKLLFGTQLLKLAALVGDCEGFGGITTKLYRYHEHFTERVLKAVY 246

  Fly   275 EINATAAAPNSVICHGDLWVNNIMFRSEPE----EVIFFDLQAMRKSSPIFDILHFIYTSTR-RP 334
            .:...    ::|:.|||||||||.|:.:.|    :|...|.|.....|..|||.:|:.||.. ..
  Fly   247 PLRGN----HNVLNHGDLWVNNIFFKYDAEYTVQQVKIIDFQLCFYGSLGFDINYFLNTSLELEV 307

  Fly   335 LRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWIL 399
            ||| ....|:..|.::|.:.|:|          |....|..|.:.:..:..::..||..:.....
  Fly   308 LRD-RRQELVDIYYRSLVDCLKH----------LPWSKELPSYEDIMDEIRKREAYGFFVAFGFF 361

  Fly   400 P-----AVTFDPNNLPN----------LDVMSEQNL-TGKEIKCT 428
            |     .|..:.|:|.|          :.:|.|.|. |.:.:|||
  Fly   362 PLMSMIGVDSEDNSLKNFHDETFARQKVQLMFEGNTRTLESLKCT 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 87/312 (28%)
P-loop_NTPase <357..435 CDD:304359 18/88 (20%)
CG7135NP_573269.1 EcKinase 43..330 CDD:281023 88/324 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.