DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG31300

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:486 Identity:96/486 - (19%)
Similarity:167/486 - (34%) Gaps:154/486 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NAEHLRQLFS------QSKLVSFSIAHIACSAGSSSGDNYMSVVKRVT--------------ISQ 79
            |.:.:.::.|      :.|:|...|     :..|:.||:|.||:.|.|              |.:
  Fly    22 NRQFIEEILSAYEDSPELKVVDLKI-----TPASAQGDHYASVMFRTTAECTTAKGKFSRPLIIK 81

  Fly    80 AGKDQDPELAGSEIVTVIVKRQIASLSRRQLYRCEEAFSNEINAYRHLAP-----LLAAHSRHQL 139
            |..:||..           |:.:.|.|        ..|..||..|..:.|     |..:....:|
  Fly    82 AMPEQDGH-----------KKDMLSES--------HLFETEIGMYCQVLPEFERILRESGDDTKL 127

  Fly   140 FPVCHIAESQDRRDAEGGEPIIVLQDLKAMGFR-MKDRLAGLELSDCLLVMKKLAQLHAASLAAQ 203
            |..|.....:.|:       :::.:||...|:. ::||....|  :......|||:.||.|:.  
  Fly   128 FVPCIYHSLEPRK-------VMIFEDLVPQGYYVIRDRPVAQE--ELKTAFAKLAKWHAISMK-- 181

  Fly   204 ELESSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTNL 268
                              |..|..||.     ...:..|..:.....|..:||.::...|:...|
  Fly   182 ------------------YIKEQPDFL-----KEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRL 223

  Fly   269 ---------FENLK--------------HEINATAAAPNSVICHGDLWVNNIMFRSEP-----EE 305
                     ||.:|              ||...:.|.  .|:||||..:.|:||::..     |:
  Fly   224 PELRKYKPHFEKIKDKYMQRLQAVMKEYHENRKSDAF--YVLCHGDFHLRNMMFKNNKGTGAHED 286

  Fly   306 VIFFDLQAMRKSSPIFDILHFIY----TSTRRPL-RDV--HTDTLLAAYSQALSEELRHQLEDTT 363
            .:..|.|.........|:.:.||    ...||.: :|:  |..|:|.|..:::.    :..|..|
  Fly   287 TMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIG----YPGELPT 347

  Fly   364 AAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWILPAV------TFDPNNLPNLDVMSEQNLTG 422
            .|:..:|:             .:..:|...:....||.:      :|..|:|          :..
  Fly   348 QAKLWDEI-------------HKNKYYDFFLLSTFLPLILAIKSKSFKVNDL----------IQD 389

  Fly   423 KEIKCTQMLTSEYHMRIRELVMEFYELGYLQ 453
            .|.:........|...:.:|:.:|.:|||.:
  Fly   390 PETRQKTYFLDTYVKDVSKLLPKFEQLGYFK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 73/346 (21%)
P-loop_NTPase <357..435 CDD:304359 11/83 (13%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 73/347 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.