DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG31099

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:384 Identity:82/384 - (21%)
Similarity:150/384 - (39%) Gaps:73/384 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 IVTVIVKRQIASLSRRQLYRCEEA----------------FSNEINAYRHLAPLLAAHSRHQLFP 141
            ::.:.||.|:...:.::|:...:|                |..|...|.::.|.|....| ::..
  Fly    47 LLPIQVKVQLRDFTMKKLFFLLKAQHGTDIQAMVMNQLKMFQREHQVYHNVLPKLEEIYR-EVGK 110

  Fly   142 VCHIAESQDRRDAEGGEPIIVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELE 206
            .........|.|...|...::|:||||..::..:|.||........|:|||||.||||       
  Fly   111 KVSFGPRAFRLDYSIGVQYVLLEDLKAKSYKNVERQAGFNKLCLKQVLKKLAQFHAAS------- 168

  Fly   207 SSSFAFHADHLQEIVYCDEATDFYATILDTSV-----QQALESLGDANADDCLTTPIRLLEELRT 266
                          ..|.|....::.:|...|     :..|:.|.|...........||.:....
  Fly   169 --------------AVCVEKHGAFSNLLVNGVYTKANESVLQELNDPEIFLSQLRRWRLGDHFHK 219

  Fly   267 NLFENLKHEINATAA--APNS----VICHGDLWVNNIMFRSEP----EEVIFFDLQAMRKSSPIF 321
            .|.|..|..::....  :|:|    |:.|.|.||||:||:.:.    |:....|.|.::..||..
  Fly   220 RLVEKEKDLVDGLLKLHSPDSNEFNVLNHSDCWVNNVMFKFDDSGHVEDTALLDYQLVKYGSPAI 284

  Fly   322 DILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVR 386
            |:.:.|.:|..:.::....|.::..|...|.:.|: .|....:..:|:.:.:|.:..        
  Fly   285 DLYYTILSSAEKDIKLAQFDNMVQYYFYHLLDNLK-ALNFGGSLPQLQHIRDALNKN-------- 340

  Fly   387 QVHYGLAIGMWILPAVTFDPNNLPNL--DVMSEQNLTGKEIKCTQMLTSEYHMRIRELV 443
                |||..:.:..|:   |..:.|.  |.::|:  ...::||....:.:|...|::::
  Fly   341 ----GLAAYVVVTRAL---PITMMNQFEDEVNER--YASKMKCAMFTSRKYIQAIKDIL 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 67/294 (23%)
P-loop_NTPase <357..435 CDD:304359 13/79 (16%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 68/298 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.