DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG31288

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:456 Identity:103/456 - (22%)
Similarity:168/456 - (36%) Gaps:116/456 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KLVSFSIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGS-EIVTVIVKRQIASLSRRQL 110
            |::.|::.     |....|:|:.|.:.||.|....||      || :..|.|.|..:.       
  Fly    38 KVLKFTVV-----AAIPPGENFTSTMLRVYIKLEMKD------GSVKTKTYIFKTMLP------- 84

  Fly   111 YRCEEAFSNEIN----------AYRHLAPLLAAHSRH-----QLFPVCHIAESQDRRDAEGGEPI 160
               ||...::||          .|:...|...|..:.     ||.|.|...|.::      |:..
  Fly    85 ---EERGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLHTEERE------GDIH 140

  Fly   161 IVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELES---SSFA----------F 212
            .:.:||....|:..||..||::......::|||:.||||...:||..   |.|:          |
  Fly   141 FIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVYEELHGPYPSEFSEGFVKKDVKKF 205

  Fly   213 HADHLQEIVYCDEATDFYATILDTSVQQALESLGDANAD--------------DCLTTPIRLLEE 263
            |.|..|              :.:.:.::|:.|.|..:||              .||:|     .|
  Fly   206 HVDGFQ--------------LKEKAYKKAMLSWGLKDADKYIKAFPTVKQYWAQCLST-----LE 251

  Fly   264 LRTNLFENLKHEINATAAAPNSVICHGDLWVNNIMFRSEP----EEVIFFDLQAMRKSSPIFDIL 324
            |..:.|    |.:|           |||.|.:|:|....|    |::|..|.|.:...||..|:|
  Fly   252 LNPDEF----HVLN-----------HGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLL 301

  Fly   325 HFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVH 389
            .|:..|....||....|..:..|.:.|.|.|: .|:......:|.:|..:.:.:..|       .
  Fly   302 FFLTLSPTNDLRIKEFDHFVRIYWERLVECLK-VLKLKKPLPKLRDLQNSMNNKNHS-------F 358

  Fly   390 YGLAIGMWILPAVTFDPNNLPNLDVMSEQNLTGKEIKCTQMLTSEYHMRIRELVMEFYELGYLQM 454
            |.....:..||.:.|..:...|:..:|.....|:..:...:....:...:::|....|..|.|..
  Fly   359 YAFFSILNHLPIILFPTDKDSNIHNLSANTEEGENYRLRLLSNPAFGNVMKDLYPFLYNRGILNF 423

  Fly   455 Q 455
            :
  Fly   424 E 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 85/338 (25%)
P-loop_NTPase <357..435 CDD:304359 11/77 (14%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 83/336 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.910

Return to query results.
Submit another query.