DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and CG33301

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:360 Identity:80/360 - (22%)
Similarity:148/360 - (41%) Gaps:91/360 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LRQLFSQSKLVSF------SIAHIACSAGSSSGDNYMSVVKRVTISQAGKDQDPELAGSEIV--T 95
            |...:.|.:|.::      .:..|.....:..|:|::.|:.|:.:       |.:|....:|  |
  Fly     6 LTAAYLQPRLRAYCQDDRLQVLRIWAKPATGKGENFVGVMTRIYV-------DYQLGDGSVVNKT 63

  Fly    96 VIVKRQI-ASLSRRQLYRCEEAFSNEINAYRHLAPLLAAHSRHQLFPVCHIAE--SQDRRDAEGG 157
            .|||:.: |.:.:.:::...|.::.|::.|..:.|.|     .:|.....:.:  :.|....:..
  Fly    64 YIVKQALSAEVPQAEVFFEYELYTREMDMYEFILPKL-----KELLQEAGLDQKLTADAITVDRE 123

  Fly   158 EPIIVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSFAFHADHLQEIVY 222
            ...::|:||....|...||:..|:::...|.::.||:.||||:..||.       |.:.|.:..|
  Fly   124 YNTMILEDLAPYKFVNADRVKQLDMAHTELTLEMLAKFHAASIVLQER-------HPNLLTKCFY 181

  Fly   223 CDEATDFYA------TILDTSVQQAL-----------ESLGDANADDCLTTPIRLLEELRTNLFE 270
                |.|::      :::...:.:|.           |:.||.            |.:|||::.|
  Fly   182 ----THFFSRDKKAYSVVFAGLFKAFLRFIDGQPNLKEAYGDK------------LHKLRTHIME 230

  Fly   271 -----------NLKHEINATAAAPNSVICHGDLWVNNIMFR----SEPEEVIFFDLQAMRKSSPI 320
                       :||            .:.|||.|..||||:    .||..|:..|.|....:||.
  Fly   231 YGARAYDVGESDLK------------TLNHGDCWTTNIMFQYDDAGEPRSVVAIDFQFSNCTSPT 283

  Fly   321 FDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEEL 355
            .|:.:|..||.|..:.|..:: |:..:.:||...|
  Fly   284 IDLHYFFTTSLREEVGDKESE-LVEHHYKALKANL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 76/328 (23%)
P-loop_NTPase <357..435 CDD:304359
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 76/329 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
43.910

Return to query results.
Submit another query.