DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and T16G1.3

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:273 Identity:64/273 - (23%)
Similarity:113/273 - (41%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 VMKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADD 252
            ::|.||...|.||...:.|..|...:  .|::||....:.:...:|.:...|...|.|.:| ||.
 Worm   148 ILKSLAVFQAESLKLNKREQESVTGY--DLEKIVGKMFSQNGLNSIFEQVRQINKEELSEA-ADK 209

  Fly   253 CLTTPIRLLEELRTNLFENLKHEINATAAAPNSVICHGDLWVNNIMFRSEPEEV---IFFDLQAM 314
            .....:.|:.      |:.:|: :|.......:|:.|||||..|||::...:|.   ...|.|::
 Worm   210 IAVFGVELVN------FDLVKN-LNNYLGIKKNVLVHGDLWSANIMWKENKDEFRVDKIIDYQSI 267

  Fly   315 RKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQR 379
            ...:|..|::....::.....|..:.:.||..:.:...|    .|||......||:|.|::.|  
 Worm   268 HLGNPAEDLVRLFISTLSGSERQKYWEKLLEQFYEYFIE----ALEDKNVPYTLEQLKESYRL-- 326

  Fly   380 LSSDYVRQVHYGLAIGMWILPAVTFDPNNLPNLDVMSEQN--------LTGKEIKCTQMLTSEY- 435
                      |.:...:.:||  .|.|.....|..||:.:        ||.|    |:.|.::. 
 Worm   327 ----------YFVTGSLLMLP--MFGPIAEVKLAEMSDPDEVKKYREILTEK----TKRLLNDME 375

  Fly   436 --HMRIRELVMEF 446
              |:..||::.::
 Worm   376 HRHLYTREIIKKW 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 40/171 (23%)
P-loop_NTPase <357..435 CDD:304359 21/85 (25%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 62/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.