DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and H06H21.8

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001023255.1 Gene:H06H21.8 / 186700 WormBaseID:WBGene00019164 Length:388 Species:Caenorhabditis elegans


Alignment Length:335 Identity:78/335 - (23%)
Similarity:137/335 - (40%) Gaps:83/335 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TVIVKRQIASLSRRQLYRCEEAFSNEINAYRHLAPLLAAHSRHQ-------------LFPVCHIA 146
            :|.:|  :..:|...| |||:.     :|..||..:|..:|:.:             .||...:.
 Worm    60 SVFIK--VPRISENVL-RCEDE-----SAVNHLNDVLLYYSKKENLFYKHFEYGSIPNFPFPKVY 116

  Fly   147 ESQD-RRDAEGGEPIIVLQDLKAMGFRMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELESSSF 210
            .::| ..:|.||   ||.::|....|.: :.:.||:....|.:|:.||.||            ||
 Worm   117 FTEDINGEATGG---IVAENLSEKVFAV-EHIPGLKHEQILRLMEALAGLH------------SF 165

  Fly   211 AFHAD---HLQEIVYCDEATDFYATILDTSVQQALESLGDANADDCLTTPIRLLEELRTNLFEN- 271
            ....|   :::..|......:.::           |.:.:...::.||     ||.:...:|.| 
 Worm   166 LMKRDDKSYVESFVEGAHGRETFS-----------EGMQNMMFEEALT-----LENVSPEVFGND 214

  Fly   272 ------------LKHEINATA-AAPNSVICHGDLWVNNIMFR--SEPEEV-IFFDLQAMRKSSPI 320
                        :|::..|.| :|...:|||.||.|.|::::  |..:|: ...|.|.:...|..
 Worm   215 RIRNIKWSFDYSIKNKATADAISAFPGIICHADLNVTNVLWKKDSAKDEISAIIDYQMLFIGSIA 279

  Fly   321 FDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEELCEAFSL-QRLSSDY 384
            |||:..:.....|.:|...|...|..|.:.|:|     |.:..|...:|||...:|| ...||::
 Worm   280 FDIIRVLTLGLNREIRRKMTQNYLDHYHKTLTE-----LSNGKAPFSMEELLHQYSLIYPFSSNF 339

  Fly   385 VRQVHYGLAI 394
            ..   :|:|:
 Worm   340 SL---FGIAL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 67/295 (23%)
P-loop_NTPase <357..435 CDD:304359 11/39 (28%)
H06H21.8NP_001023255.1 CHK 129..312 CDD:214734 48/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.