DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and E02C12.9

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:129 Identity:28/129 - (21%)
Similarity:44/129 - (34%) Gaps:25/129 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 SVICHGDLWVNNIMFRSEP------EEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTL 343
            ||:.|||||.:|::...|.      |.:|  |.|:.....|..|....|........|......|
 Worm   204 SVLNHGDLWQSNMIHSMENNGKLKLEAII--DWQSTVILPPGLDTAELIVGCLSAEDRREKGHDL 266

  Fly   344 LAAYSQALSEELRHQLEDTTAAERLEELCEAFSLQRLSSDYVRQVHYGLAIGMWILPAVTFDPN 407
            |..|.:.......               .|.||.:.|...|  .:::.:|..:.:...::|..|
 Worm   267 LLLYHKTFINVFG---------------SEVFSFEELQDSY--NLYFPMAAILIVPGMISFMTN 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 20/77 (26%)
P-loop_NTPase <357..435 CDD:304359 8/51 (16%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.