DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and C29F7.2

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_510235.2 Gene:C29F7.2 / 181463 WormBaseID:WBGene00007811 Length:394 Species:Caenorhabditis elegans


Alignment Length:334 Identity:74/334 - (22%)
Similarity:126/334 - (37%) Gaps:64/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SSG--DN----YMSVVKRVTISQAGKDQDP----------ELAGSEIVTVIVKRQIASLSRRQLY 111
            :||  ||    |||::::|.:....:.::.          ::|.|...|.::....|.::.....
 Worm    32 TSGILDNSELGYMSMIRKVQLHFDAEHEESHPNLPKHVVLKIACSSKGTGVLDSAGADMTETDHS 96

  Fly   112 RCEEAF--SNEINAYRHLAPLLAAHSRHQLFPVCHIAESQDRRDAEGGEPIIVL---QDLKAMGF 171
            ...|.|  :.|.|.|:..|.|.   .:....||.:.|...:  |.|...|:||:   :|.|    
 Worm    97 ANVELFMHNTECNYYKIFAKLT---EKPLHLPVIYAAIKAE--DKEAPVPVIVMEMFEDCK---- 152

  Fly   172 RMKDRLAGLELSDCLLVMKKLAQLHAASLAAQELES---SSFAFH-ADHLQEIVYCDEATDFYAT 232
             :.|.:.|........::.::.:||..||..:|.::   .:|... |.:.|.:|         |.
 Worm   153 -VYDIITGFNEEQLYKIVDEIVKLHIFSLTTEEWKTIVPDAFVLEMAGYFQTMV---------AG 207

  Fly   233 ILDTSVQQALESLGDANADDCLTTPIRLLEELRTNLFENLKHEINATAAAPNSVICHGDLWVNNI 297
            |.:...||....|......:...|..:.|:.:.....|..:          .||:.|||||...|
 Worm   208 IGEKLAQQPGLELVSTYIKNTFATDPKFLQNINDEYLEERR----------ISVLTHGDLWAPQI 262

  Fly   298 MFRSEPEEVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEEL------- 355
            ::....:.....|.|...:.||:.|..|.:.|.|....|...|..||..|...||..|       
 Worm   263 LWDKNDDIAGIIDWQITHRGSPMEDFHHIMSTCTSVENRKNLTKPLLDYYFDKLSSGLEAKGVKM 327

  Fly   356 ---RHQLED 361
               |.::|:
 Worm   328 PWTREEIEE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 71/326 (22%)
P-loop_NTPase <357..435 CDD:304359 1/5 (20%)
C29F7.2NP_510235.2 CHK 142..321 CDD:214734 46/202 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.