DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and T16G1.4

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_506236.2 Gene:T16G1.4 / 179776 WormBaseID:WBGene00011798 Length:424 Species:Caenorhabditis elegans


Alignment Length:276 Identity:64/276 - (23%)
Similarity:109/276 - (39%) Gaps:55/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 VMKKLAQLHAASLAAQELESSSFA-FHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANAD 251
            |:|.:|:|.|.||...:.|..|.| |....:...::.:|.       :..:.:|..|        
 Worm   185 VLKSIARLQAESLHLTDQEKQSIAGFDLKKMSNTIFSEEG-------MQNNFKQTRE-------- 234

  Fly   252 DCLTTPIRLLEEL------RTNLFENLKH-EINATAAAPNSVICHGDLWVNNIMFRSEPEEVI-- 307
               ..|.||.|.:      .|.|.:..|. .:|:.......|:.|||||..||::.....:.:  
 Worm   235 ---INPERLKESVDKVEIYGTELVDLDKAINLNSYIGIERDVLVHGDLWSANILWEENEGKFLVS 296

  Fly   308 -FFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAERLEEL 371
             ..|.|.:...:|..|::..:..:.....|..|.:.||..:.:...|    .|:|......||:|
 Worm   297 KVIDYQLIHMGNPAEDLVRLLLCTLSGADRQAHWERLLEQFYEYFLE----ALQDNETPYSLEQL 357

  Fly   372 CEAFSLQRLSSDYVRQVHYGLAIGMWILPAVTFDPNNLPNLDVMSEQNLTGKEIKCTQMLTSEYH 436
            .|::          ||  |.:..|:::||  .|.|.....|...|: |...:|.:  ::||.:  
 Worm   358 KESY----------RQ--YFVTAGLFMLP--MFGPIAQMKLSYSSD-NEHAEEYR--EVLTEK-- 403

  Fly   437 MRIRELVMEFYELGYL 452
               .|.:||..|..:|
 Worm   404 ---AERLMEDLERWHL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 39/179 (22%)
P-loop_NTPase <357..435 CDD:304359 20/77 (26%)
T16G1.4NP_506236.2 DUF1679 7..419 CDD:369592 64/276 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.