DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5644 and T16G1.7

DIOPT Version :9

Sequence 1:NP_648274.1 Gene:CG5644 / 39029 FlyBaseID:FBgn0035948 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_506233.1 Gene:T16G1.7 / 179774 WormBaseID:WBGene00011801 Length:436 Species:Caenorhabditis elegans


Alignment Length:287 Identity:66/287 - (22%)
Similarity:104/287 - (36%) Gaps:64/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 VMKKLAQLHAASLAAQELESSSFAFHADHLQEIVYCDEATDFYATILDTSVQQALESLGDANADD 252
            |::.||.|.|.||...|          |.:..|...|......|.:.:..::...|...:.|   
 Worm   188 VLRSLATLQAGSLHLTE----------DEINSISGFDFKQMMGAMMNEEGMKNIYEQTREIN--- 239

  Fly   253 CLTTPIRLLEELRTNLFE---------NLKHEINATAAAPNSVICHGDLWVNNIMFRSEPE---- 304
                |.||.|  :||..|         .|...:|........|:.|||||..||:::.|.:    
 Worm   240 ----PERLTE--KTNTVEAFGLEVVNFELSCNLNKYVGIERDVLVHGDLWAANILWKEENDGKFS 298

  Fly   305 --EVIFFDLQAMRKSSPIFDILHFIYTSTRRPLRDVHTDTLLAAYSQALSEELRHQLEDTTAAER 367
              :||  |.|.:...:|..|::....::.....|..|.:.||..:.:...|    .|.|......
 Worm   299 VSKVI--DYQLIHMGNPAEDLVRVFLSTLSGADRQAHWERLLEQFYEYFLE----ALGDDKPPYS 357

  Fly   368 LEELCEAFSLQRLSSDYVRQVHYGLAIGMWILPAVTFDPNNLPNLDV-MSEQNLTGKEIKCTQML 431
            ||:|.|::....:|...|....||                  |...| :|..|.|....:..::|
 Worm   358 LEQLKESYRCYFVSGGLVMMPMYG------------------PIAQVKLSYSNDTESVEEYREIL 404

  Fly   432 TSEYHMRIRELVMEFYELGYLQMQKET 458
            |.:     .|.:||..|..:|..:.:|
 Worm   405 TEK-----AEHLMEDLERWHLYSKDKT 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5644NP_648274.1 EcKinase 65..357 CDD:281023 43/183 (23%)
P-loop_NTPase <357..435 CDD:304359 17/78 (22%)
T16G1.7NP_506233.1 DUF1679 10..423 CDD:369592 65/282 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.